Sign in or Register   Sign in or Register
  |  

Mouse Anti-CD14 Recombinant Antibody (CBXC-1875) (CBMAB-C4132-CQ)

This product is a mouse antibody that recognizes CD14. The antibody CBXC-1875 can be used for immunoassay techniques such as: WB, IHC.
See all CD14 antibodies

Summary

Host Animal
Mouse
Specificity
Human
Clone
CBXC-1875
Antibody Isotype
IgG1
Application
WB, IHC

Basic Information

Immunogen
Recombinant protein corresponding to amino acids: PCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSL
Specificity
Human
Antibody Isotype
IgG1
Clonality
Monoclonal
Application Notes
The COA includes recommended starting dilutions, optimal dilutions should be determined by the end user.

Formulations & Storage [For reference only, actual COA shall prevail!]

Storage
Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze/thaw cycles.

Target

Full Name
CD14 Molecule
Introduction
CD14 (CD14 Molecule) is a Protein Coding gene. Diseases associated with CD14 include Mycobacterium Chelonae and Croup. Among its related pathways are Bacterial infections in CF airways and Development Slit-Robo signaling. Gene Ontology (GO) annotations related to this gene include lipopolysaccharide binding and lipoteichoic acid binding.
Entrez Gene ID
UniProt ID
Alternative Names
CD14 Molecule; CD14 Antigen; Myeloid Cell-Specific Leucine-Rich Glycoprotein;
Function
Coreceptor for bacterial lipopolysaccharide (PubMed:1698311, PubMed:23264655).
In concert with LBP, binds to monomeric lipopolysaccharide and delivers it to the LY96/TLR4 complex, thereby mediating the innate immune response to bacterial lipopolysaccharide (LPS) (PubMed:20133493, PubMed:23264655, PubMed:22265692).
Acts via MyD88, TIRAP and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response (PubMed:8612135).
Acts as a coreceptor for TLR2:TLR6 heterodimer in response to diacylated lipopeptides and for TLR2:TLR1 heterodimer in response to triacylated lipopeptides, these clusters trigger signaling from the cell surface and subsequently are targeted to the Golgi in a lipid-raft dependent pathway (PubMed:16880211).
Binds electronegative LDL (LDL-) and mediates the cytokine release induced by LDL- (PubMed:23880187).
Biological Process
Apoptotic process Source: ProtInc
Apoptotic signaling pathway Source: Reactome
Cell surface receptor signaling pathway Source: ProtInc
Cellular response to diacyl bacterial lipopeptide Source: UniProtKB
Cellular response to lipopolysaccharide Source: MGI
Cellular response to lipoteichoic acid Source: MGI
Cellular response to molecule of bacterial origin Source: CAFA
Cellular response to triacyl bacterial lipopeptide Source: UniProtKB
I-kappaB kinase/NF-kappaB signaling Source: Reactome
Inflammatory response Source: GO_Central
Innate immune response Source: UniProtKB-KW
Lipopolysaccharide-mediated signaling pathway Source: GO_Central
MyD88-dependent toll-like receptor signaling pathway Source: Reactome
MyD88-independent toll-like receptor signaling pathway Source: Reactome
Necroptotic process Source: Reactome
Negative regulation of MyD88-independent toll-like receptor signaling pathway Source: Reactome
Neutrophil degranulation Source: Reactome
Phagocytosis Source: ProtInc
Positive regulation of endocytosis Source: Ensembl
Positive regulation of interferon-gamma production Source: UniProtKB
Positive regulation of interleukin-8 production Source: CAFA
Positive regulation of NIK/NF-kappaB signaling Source: AgBase
Positive regulation of tumor necrosis factor production Source: AgBase
Positive regulation of type I interferon production Source: GO_Central
Receptor-mediated endocytosis Source: Ensembl
Response to electrical stimulus Source: Ensembl
Response to ethanol Source: Ensembl
Response to heat Source: Ensembl
Response to magnesium ion Source: Ensembl
Response to tumor necrosis factor Source: Ensembl
Toll-like receptor 4 signaling pathway Source: UniProtKB
Toll-like receptor signaling pathway Source: Reactome
Toll-like receptor TLR1:TLR2 signaling pathway Source: Reactome
Toll-like receptor TLR6:TLR2 signaling pathway Source: Reactome
TRIF-dependent toll-like receptor signaling pathway Source: Reactome
Cellular Location
Golgi apparatus; Secreted; Cell membrane; Membrane raft. Secreted forms may arise by cleavage of the GPI anchor.
PTM
N- and O- glycosylated. O-glycosylated with a core 1 or possibly core 8 glycan.

Ciesielska, A., Matyjek, M., & Kwiatkowska, K. (2021). TLR4 and CD14 trafficking and its influence on LPS-induced pro-inflammatory signaling. Cellular and molecular life sciences, 78(4), 1233-1261.

Won, Y., Yang, J. I., Park, S., & Chun, J. S. (2021). Lipopolysaccharide Binding Protein and CD14, Cofactors of Toll‐like Receptors, Are Essential for Low‐Grade Inflammation–Induced Exacerbation of Cartilage Damage in Mouse Models of Posttraumatic Osteoarthritis. Arthritis & Rheumatology (Hoboken, Nj), 73(8), 1451.

Roedig, H., Damiescu, R., Zeng-Brouwers, J., Kutija, I., Trebicka, J., Wygrecka, M., & Schaefer, L. (2020, May). Danger matrix molecules orchestrate CD14/CD44 signaling in cancer development. In Seminars in cancer biology (Vol. 62, pp. 31-47). Academic Press.

Wu, Z., Zhang, Z., Lei, Z., & Lei, P. (2019). CD14: Biology and role in the pathogenesis of disease. Cytokine & growth factor reviews, 48, 24-31.

Thomas, A. M., Gerogianni, A., McAdam, M. B., Fløisand, Y., Lau, C., Espevik, T., ... & Barratt-Due, A. (2019). Complement component C5 and TLR molecule CD14 mediate heme-induced thromboinflammation in human blood. The Journal of Immunology, 203(6), 1571-1578.

Roedig, H., Nastase, M. V., Frey, H., Moreth, K., Zeng-Brouwers, J., Poluzzi, C., ... & Schaefer, L. (2019). Biglycan is a new high-affinity ligand for CD14 in macrophages. Matrix Biology, 77, 4-22.

Tsukamoto, H., Takeuchi, S., Kubota, K., Kobayashi, Y., Kozakai, S., Ukai, I., ... & Tomioka, Y. (2018). Lipopolysaccharide (LPS)-binding protein stimulates CD14-dependent Toll-like receptor 4 internalization and LPS-induced TBK1–IKKϵ–IRF3 axis activation. Journal of Biological Chemistry, 293(26), 10186-10201.

Kim, S. J., & Kim, H. M. (2017). Dynamic lipopolysaccharide transfer cascade to TLR4/MD2 complex via LBP and CD14. BMB reports, 50(2), 55.

Ryu, J. K., Kim, S. J., Rah, S. H., Kang, J. I., Jung, H. E., Lee, D., ... & Kim, H. M. (2017). Reconstruction of LPS transfer cascade reveals structural determinants within LBP, CD14, and TLR4-MD2 for efficient LPS recognition and transfer. Immunity, 46(1), 38-50.

da Silva, T. A., Zorzetto-Fernandes, A. L., Cecílio, N. T., Sardinha-Silva, A., Fernandes, F. F., & Roque-Barreira, M. C. (2017). CD14 is critical for TLR2-mediated M1 macrophage activation triggered by N-glycan recognition. Scientific reports, 7(1), 1-14.

Ask a question We look forward to hearing from you.
0 reviews or Q&As
Loading...
Have you used Mouse Anti-CD14 Recombinant Antibody (CBXC-1875)?
Submit a review and get a Coupon or an Amazon gift card. 20% off Coupon $30 eGift Card
Submit a review
Loading...
For research use only. Not intended for any clinical use.

Custom Antibody Labeling

We also offer labeled antibodies developed using our catalog antibody products and nonfluorescent conjugates (HRP, AP, Biotin, etc.) or fluorescent conjugates (Alexa Fluor, FITC, TRITC, Rhodamine, Texas Red, R-PE, APC, Qdot Probes, Pacific Dyes, etc.).

Online Inquiry

Documents

Contact us

  • Tel: (USA)
  • (UK)
  • Fax:
  • Email:

Submit A Review

Go to
Compare