Sign in or Register   Sign in or Register
  |  

Mouse Anti-CD3E Recombinant Antibody (CBXC-1874) (CBMAB-C4094-CQ)

This product is a mouse antibody that recognizes CD3E. The antibody CBXC-1874 can be used for immunoassay techniques such as: WB, IHC.
See all CD3E antibodies

Summary

Host Animal
Mouse
Specificity
Human
Clone
CBXC-1874
Antibody Isotype
IgG1
Application
WB, IHC

Basic Information

Immunogen
Recombinant protein corresponding to amino acids: NEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMD
Specificity
Human
Antibody Isotype
IgG1
Clonality
Monoclonal
Application Notes
The COA includes recommended starting dilutions, optimal dilutions should be determined by the end user.

Formulations & Storage [For reference only, actual COA shall prevail!]

Storage
Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze/thaw cycles.

Target

Full Name
CD3e Molecule
Introduction
CD3E (CD3e Molecule) is a Protein Coding gene. Diseases associated with CD3E include Immunodeficiency 18 and T-B+ Severe Combined Immunodeficiency Due To Cd3delta/Cd3epsilon/Cd3zeta. Among its related pathways are G-protein signaling N-RAS regulation pathway and Toll-like receptor signaling pathway. Gene Ontology (GO) annotations related to this gene include protein heterodimerization activity and signal transducer activity.
Entrez Gene ID
UniProt ID
Alternative Names
CD3e Molecule; CD3e Antigen, Epsilon Polypeptide (TiT3 Complex); T-Cell Surface Antigen T3/Leu-4 Epsilon Chain; CD3e Molecule, Epsilon (CD3-TCR Complex); T3E; T-Cell Antigen Receptor Complex, Epsilon Subunit Of T3;
Function
Part of the TCR-CD3 complex present on T-lymphocyte cell surface that plays an essential role in adaptive immune response. When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain. Upon TCR engagement, these motifs become phosphorylated by Src family protein tyrosine kinases LCK and FYN, resulting in the activation of downstream signaling pathways (PubMed:2470098).
In addition of this role of signal transduction in T-cell activation, CD3E plays an essential role in correct T-cell development. Initiates the TCR-CD3 complex assembly by forming the two heterodimers CD3D/CD3E and CD3G/CD3E. Participates also in internalization and cell surface down-regulation of TCR-CD3 complexes via endocytosis sequences present in CD3E cytosolic region (PubMed:10384095, PubMed:26507128).
Biological Process
Adaptive immune response Source: UniProtKB-KW
Apoptotic signaling pathway Source: Ensembl
Cell surface receptor signaling pathway Source: GO_Central
Cerebellum development Source: Ensembl
Dendrite development Source: Ensembl
G protein-coupled receptor signaling pathway Source: ProtInc
Negative regulation of gene expression Source: UniProtKB
Negative regulation of smoothened signaling pathway Source: Ensembl
Negative thymic T cell selection Source: Ensembl
Positive regulation of alpha-beta T cell proliferation Source: Ensembl
Positive regulation of calcium-mediated signaling Source: Ensembl
Positive regulation of cell-cell adhesion mediated by integrin Source: BHF-UCL
Positive regulation of cell-matrix adhesion Source: BHF-UCL
Positive regulation of gene expression Source: UniProtKB
Positive regulation of interferon-gamma production Source: Ensembl
Positive regulation of interleukin-2 production Source: Ensembl
Positive regulation of interleukin-4 production Source: Ensembl
Positive regulation of peptidyl-tyrosine phosphorylation Source: Ensembl
Positive regulation of T cell anergy Source: Ensembl
Positive regulation of T cell proliferation Source: UniProtKB
Positive thymic T cell selection Source: GO_Central
Protein-containing complex assembly Source: UniProtKB
Regulation of apoptotic process Source: UniProtKB
Regulation of immune response Source: Reactome
Response to nutrient Source: Ensembl
Signal complex assembly Source: ProtInc
T cell activation Source: UniProtKB
T cell costimulation Source: Ensembl
T cell receptor signaling pathway Source: Reactome
Transmembrane receptor protein tyrosine kinase signaling pathway Source: ProtInc
Cellular Location
Cell membrane
Involvement in disease
Immunodeficiency 18 (IMD18): An autosomal recessive primary immunodeficiency characterized by onset in infancy or early childhood of recurrent infections. The severity is variable, encompassing both a mild immunodeficiency and severe combined immunodeficiency (SCID), resulting in early death without bone marrow transplantation in some patients. Immunologic work-up of the IMD18 SCID patients shows a T cell-negative, B cell-positive, natural killer (NK) cell-positive phenotype, whereas T-cell development is not impaired in the mild form of IMD18.
Topology
Extracellular: 23-126
Helical: 127-152
Cytoplasmic: 153-207
PTM
Phosphorylated on Tyr residues after T-cell receptor triggering by LCK in association with CD4/CD8.
Ask a question We look forward to hearing from you.
0 reviews or Q&As
Loading...
Have you used Mouse Anti-CD3E Recombinant Antibody (CBXC-1874)?
Submit a review and get a Coupon or an Amazon gift card. 20% off Coupon $30 eGift Card
Submit a review
Loading...
For research use only. Not intended for any clinical use.

Custom Antibody Labeling

We also offer labeled antibodies developed using our catalog antibody products and nonfluorescent conjugates (HRP, AP, Biotin, etc.) or fluorescent conjugates (Alexa Fluor, FITC, TRITC, Rhodamine, Texas Red, R-PE, APC, Qdot Probes, Pacific Dyes, etc.).

Online Inquiry

Documents

Contact us

  • Tel: (USA)
  • (UK)
  • Fax:
  • Email:

Submit A Review

Go to
Compare