Sign in or Register
  |  

Human papillomavirus type 16 E2 Peptide (QVDYYGLYYVHEGIRTYFVQFKDDAEKYSK) (PEP-172041CQ)

This product is synthetic peptide that is derived from Human papillomavirus type 16 E2 (AA 151-180). This peptide sequence corresponds to amino acid residues: QVDYYGLYYVHEGIRTYFVQFKDDAEKYSK.
Specificity
HPV16
Format
Lyophilized powder
Storage
Store at -20°C
Introduction
Human papillomavirus infection is an infection by human papillomavirus (HPV). Most HPV infections cause no symptoms and resolve spontaneously. In some people, an HPV infection persists and results in warts or precancerous lesions. The precancerous lesions increase the risk of cancer of the cervix, vulva, vagina, penis, anus, mouth, or throat. Nearly all cervical cancer is due to HPV with two types, HPV16 and HPV18, accounting for 70% of cases. Between 60% and 90% of the other cancers are also linked to HPV. HPV6 and HPV11 are common causes of genital warts and laryngeal papillomatosis.
Alternative Name
HpV16gp4
Entrez Gene ID
UniProt ID
Cat PEP-172041CQ
Conjugates
Size
Price $
  ADD TO CART