Sign in or Register


This product is synthetic peptide that is derived from Human IFNA2 (AA 108-147). This peptide sequence corresponds to amino acid residues: ETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAE.
Lyophilized powder
Store at -20°C
This gene is a member of the alpha interferon gene cluster on chromosome 9. The encoded protein is a cytokine produced in response to viral infection. Use of the recombinant form of this protein has been shown to be effective in reducing the symptoms and duration of the common cold.
Alternative Name
Interferon Alpha 2
Entrez Gene ID
UniProt ID
Cat PEP-101830CQ
Price $