Sign in or Register
  |  

Creative Biolabs has successfully developed SARS, MERS and other anti-viral antibodies in the past to assist scientific research. Facing the difficult COVID-19, Creative Biolabs actively invests in antibody development to assist researchers to better understand the characteristics of 2019-nCoV and drug development. Currently, Creative Biolabs is proud to offer an extensive line of research antibodies to support the study of SARS-CoV-2/COVID-19, several of which were validated using virus-infected cell lysates.

Explore the collections of SARS-CoV-2/COVID-19 antibodies >

Human IFNA2 Peptide (TPLMKEDSILAVRKYFQRITLYLKEKKYSPCAW) (PEP-101835CQ)

This product is synthetic peptide that is derived from Human IFNA2 (AA 109-141). This peptide sequence corresponds to amino acid residues: TPLMKEDSILAVRKYFQRITLYLKEKKYSPCAW.
Specificity
Human
Format
Lyophilized powder
Storage
Store at -20°C
Introduction
This gene is a member of the alpha interferon gene cluster on chromosome 9. The encoded protein is a cytokine produced in response to viral infection. Use of the recombinant form of this protein has been shown to be effective in reducing the symptoms and duration of the common cold.
Alternative Name
Interferon Alpha 2
Entrez Gene ID
UniProt ID
Ask a question We look forward to hearing from you.
0 reviews or Q&As
Loading...
Submit a review Submit a review and you will get a coupon.
0 reviews
Loading...

Please try the standard protocols which include: protocols, troubleshooting and guide.

Click here to view the protocols, troubleshooting and guide.

Cat PEP-101835CQ
Conjugates
Size
Price $
  ADD TO CART
Request bulk or custom quote
Second antibody and isotype control