Sign in or Register
  |  

Results found for "cancer research"

Loading...
Cat Product Name Target Host Antibody Isotype Cross Reactivity Clone Application*
PEP-000470CQ Human ABI2 Peptide (ILDDIGHGV) ABI2
PEP-005621CQ Human B2M Peptide (KDWSFYLL) B2M
PEP-005616CQ Human B2M Peptide (IEKVEHSDLSFSKD) B2M
PEP-005614CQ Human B2M Peptide (HVTLSQPKIVKWDRD) B2M
PEP-005599CQ Human B2M Peptide (GFHPSDIEVDLLKNGE) B2M
PEP-004264CQ Human ARSB Peptide (GRYQIRTGL) ARSB
PEP-004018CQ Human ARHGEF2 Peptide (SVSGMTMCY) ARHGEF2
PEP-004017CQ Human ARHGEF2 Peptide (NRMDPRAQTP) ARHGEF2
PEP-004016CQ Human ARHGEF2 Peptide (FEDRERQEL) ARHGEF2
PEP-004012CQ Human ARHGEF2 Peptide (SPLGLRRIL) ARHGEF2
PEP-004010CQ Human ARHGEF2 Peptide (LPRGLFRSESL) ARHGEF2
PEP-004008CQ Human ARHGEF2 Peptide (SRHSKALKL) ARHGEF2
PEP-004005CQ Human ARHGEF2 Peptide (LQRLVNLY) ARHGEF2
PEP-003879CQ Human ARHGAP29 Peptide (QEYSEFVKA) ARHGAP29
PEP-003877CQ Human ARHGAP29 Peptide (KYTKNIVSW) ARHGAP29
PEP-003876CQ Human ARHGAP29 Peptide (KPHAPIISI) ARHGAP29
PEP-003873CQ Human ARHGAP29 Peptide (FYKPHAPII) ARHGAP29
PEP-003737CQ Human AREG Peptide (ENGNVHAIA) AREG
PEP-003005CQ Human API5 Peptide (RQIYNPPSGKY) API5
PEP-003004CQ Human API5 Peptide (KLLAEMSSF) API5
PEP-002998CQ Human API5 Peptide (NINVLIKDL) API5
PEP-002993CQ Human API5 Peptide (RQIYNPPSGK) API5
PEP-002967CQ Human APEH Peptide (EHFDASHVAL) APEH
PEP-002965CQ Human APEH Peptide (LSEPEEAAALY) APEH
PEP-002938CQ Human APAF1 Peptide (SADGTLKLW) APAF1
PEP-002490CQ Human ANKRD11 Peptide (RIKDTNKDISR) ANKRD11
PEP-002331CQ Human AMFR Peptide (TPMSSHGRVL) AMFR
PEP-002329CQ Human AMFR Peptide (LERFPWPSL) AMFR
PEP-002328CQ Human AMFR Peptide (RTAHVILRY) AMFR
PEP-002165CQ Human ALDOA Peptide (TENTEENRRF) ALDOA
PEP-002161CQ Human ALDOA Peptide (TPEQKKELSDIAHRIV) ALDOA
PEP-002158CQ Human ALDOA Peptide (SHEEIAMATVTALR) ALDOA
PEP-002157CQ Human ALDOA Peptide (SEEEASINLNAINK) ALDOA
PEP-002154CQ Human ALDOA Peptide (LSGGQSEEEASIN) ALDOA
PEP-002153CQ Human ALDOA Peptide (AHRIVAPGKGILAADE) ALDOA
PEP-002151CQ Human ALDOA Peptide (EHTPSALAI) ALDOA
PEP-002146CQ Human ALDOA Peptide (HRIVAPGKGIL) ALDOA
PEP-002142CQ Human ALDOA Peptide (VPIVEPEI) ALDOA
PEP-002137CQ Human ALDOA Peptide (IVAPGKGIL) ALDOA
PEP-002131CQ Human ALDOA Peptide (KSKGGVVGIKVDKGVVPL) ALDOA
PEP-002128CQ Human ALDOA Peptide (TADDRVNPCIGG) ALDOA
PEP-001804CQ Human AIM2 Peptide (GETPKINTL) AIM2
PEP-001795CQ Human AIFM2 Peptide (GSTGPFPGK) AIFM2
PEP-001793CQ Human AIFM2 Peptide (KDSFHHNV) AIFM2
PEP-001790CQ Human AIFM2 Peptide (NLEELPLNEY) AIFM2
PEP-001789CQ Human AIFM2 Peptide (ALADKELLPSV) AIFM2
PEP-001539CQ Human AGPAT5 Peptide (TPRIKATHV) AGPAT5
PEP-001535CQ Human AGPAT5 Peptide (YVDAGTPMY) AGPAT5
PEP-001531CQ Human AGPAT5 Peptide (LGHVRYVL) AGPAT5
PEP-001509CQ Human AGL Peptide (GRDTFIALR) AGL
PEP-001442CQ Human AFF1 Peptide (SVYSETVDLIK) AFF1
PEP-001441CQ Human AFF1 Peptide (RSSDSSSKLAK) AFF1
PEP-001440CQ Human AFF1 Peptide (ESESQSSKSAY) AFF1
PEP-001439CQ Human AFF1 Peptide (ATESESQSSKSAY) AFF1
PEP-001437CQ Human AFF1 Peptide (EAFPEKIPLF) AFF1
PEP-001434CQ Human AFF1 Peptide (RELSPLISL) AFF1
PEP-001339CQ Human ADK Peptide (VVDKDFLDKY) ADK
PEP-001324CQ Human ADI1 Peptide (VTLPAGIYHRF) ADI1
PEP-001232CQ Human ADCY7 Peptide (LPRPKGDAAL) ADCY7
PEP-001225CQ Human ADCY3 Peptide (VLGGVLGQK) ADCY3
PEP-001167CQ Human ADAMTS13 Peptide (YSANEQCRVAFGPKAVACTFARE) ADAMTS13
PEP-001164CQ Human ADAMTS13 Peptide (QAAHVWTPAAGSCSVSCGRGLMELRFLCMDSALRVPVQEELCGLASKPG) ADAMTS13
PEP-001055CQ Human ADA Peptide (NYSLNTDDPLIFKS) ADA
PEP-001054CQ Human ADA Peptide (NYSLNTDDPLIFK) ADA
PEP-001053CQ Human ADA Peptide (LNTDDPLIFK) ADA
PEP-001050CQ Human ADA Peptide (LDGSIKPETI) ADA
PEP-001017CQ Human ACTR2 Peptide (ETYQFSGVYV) ACTR2
PEP-001014CQ Human ACTR2 Peptide (HIFPAL) ACTR2
PEP-001012CQ Human ACTR2 Peptide (IEQEQKLAL) ACTR2
PEP-001011CQ Human ACTR2 Peptide (ADFETVRM) ACTR2
PEP-001010CQ Human ACTR2 Peptide (FPEHIFPAL) ACTR2
PEP-001009CQ Human ACTR2 Peptide (QEYQEKGVRVL) ACTR2
PEP-001008CQ Human ACTR2 Peptide (RRLDIAGRDI) ACTR2
PEP-000998CQ Human ACTN4 Peptide (VPQKTIQEM) ACTN4
PEP-000996CQ Human ACTN4 Peptide (RETTDTDTADQVIA) ACTN4
PEP-000994CQ Human ACTN4 Peptide (LQDMFIVH) ACTN4
PEP-000988CQ Human ACTN4 Peptide (GEAEFNRIMSL) ACTN4
PEP-000985CQ Human ACTN4 Peptide (ARPDEKAIM) ACTN4
PEP-000786CQ Human ACP4 Peptide (AHDSTLLAL) ACP4
PEP-000489CQ Human ABL2 Peptide (SRFSTLAELVH) ABL2
PEP-000362CQ Human ABCC4 Peptide (VQKGTYTEF) ABCC4
PEP-000360CQ Human ABCC4 Peptide (AVVGPVGAGK) ABCC4
PEP-000355CQ Human ABCC4 Peptide (LDPFNEHTDEELWN) ABCC4
PEP-000354CQ Human ABCC4 Peptide (KFDQVTVFL) ABCC4
PEP-000353CQ Human ABCC4 Peptide (DPFNEHTDEELWNA) ABCC4
PEP-000351CQ Human ABCC4 Peptide (VVGPVGAGK) ABCC4
PEP-000350CQ Human ABCC4 Peptide (SQQSSRPSL) ABCC4
PEP-000347CQ Human ABCC4 Peptide (RPSLKDGAL) ABCC4
PEP-000343CQ Human ABCC4 Peptide (KEYDEPYVLL) ABCC4
PEP-000342CQ Human ABCC4 Peptide (IARSLLVFY) ABCC4
PEP-000341CQ Human ABCC4 Peptide (ILKDGKMVQK) ABCC4
PEP-000333CQ Human ABCC12 Peptide (IEFDKPEVL) ABCC12
PEP-000123CQ Human MLANA Peptide (ELAGIGILTV) MLANA
PEP-000111CQ Human MAGEA3 Peptide (KKLLTQHFVQENYLEY) MAGEA3
PEP-000056CQ Human HACL1 Peptide (QFADVIVLF) HACL1
PEP-000026CQ Human CTAG1A Peptide (VLLKEFTVSGNILTI) CTAG1A
PEP-000024CQ Human CTAG1A Peptide (SLLMWTTQV) CTAG1A
PEP-000023CQ Human CTAG1A Peptide (SLLMWITQV) CTAG1A
PEP-000014CQ Human CTAG1A Peptide (AMPFATPME) CTAG1A
PEP-000013CQ Human CTAG1A Peptide (AMPFATPM) CTAG1A
(P): Predicted
* Abbreviations
IFImmunofluorescence
IHImmunohistochemistry
IPImmunoprecipitation
WBWestern Blot
EELISA
MMicroarray
CIChromatin Immunoprecipitation
FFlow Cytometry
FNFunction Assay
IDImmunodiffusion
RRadioimmunoassay
TCTissue Culture
GSGel Supershift
NNeutralization
BBlocking
AActivation
IInhibition
DDepletion
ESELISpot
DBDot Blot
MCMass Cytometry/CyTOF
CTCytotoxicity
SStimulation
AGAgonist
APApoptosis
IMImmunomicroscopy
BABioassay
CSCostimulation
EMElectron Microscopy
IEImmunoelectrophoresis
PAPeptide Array
ICImmunocytochemistry
PEPeptide ELISA
MDMeDIP
SHIn situ hybridization
IAEnzyme Immunoassay
SEsandwich ELISA
PLProximity Ligation Assay
ECELISA(Cap)
EDELISA(Det)
BIBioimaging
IOImmunoassay
LFLateral Flow Immunoassay
LALuminex Assay
CImmunohistochemistry-Frozen Sections
PImmunohistologyp-Paraffin Sections
ISIntracellular Staining for Flow Cytometry
MSElectrophoretic Mobility Shift Assay
RIRNA Binding Protein Immunoprecipitation (RIP)