Sign in or Register
  |  

Results found for "epigenetics"

Loading...
Cat Product Name Target Host Antibody Isotype Cross Reactivity Clone Application*
PEP-011968CQ Human CIAO1 Peptide (SLTAHLHQA) CIAO1
PEP-011967CQ Human CIAO1 Peptide (SYDDTVKL) CIAO1
PEP-011966CQ Human CIAO1 Peptide (RTVRIWRQY) CIAO1
PEP-011372CQ Human CHAMP1 Peptide (EALEPPLEEQQI) CHAMP1
PEP-115658CQ Human TYMP Peptide (ERMLAAQGVDPGLA) TYMP
PEP-115601CQ Human TFEB Peptide (MRLDDVLGY) TFEB
PEP-115598CQ Human TFEB Peptide (DVIDNIMRL) TFEB
PEP-115595CQ Human TFEB Peptide (SYLENPTSYHL) TFEB
PEP-115594CQ Human TRIM21 Peptide (NFLVEEEQRQLQELEKDEREQLRILGEK) TRIM21
PEP-115583CQ Human TRIM21 Peptide (KRADWKKTVETQKSR) TRIM21
PEP-115573CQ Human TRIM21 Peptide (GERCAVHGERLHLFCEKDGKALCWVCAQSRKHRDH) TRIM21
PEP-115568CQ Human TRIM21 Peptide (AFTGPLRPFF) TRIM21
PEP-115565CQ Human TRIM21 Peptide (WEVDVTGKEAW) TRIM21
PEP-115562CQ Human TRIM21 Peptide (YWEVDVTGKEAWDLGVCR) TRIM21
PEP-115555CQ Human TRIM21 Peptide (TGPLRPFFSPGFNDGGKN) TRIM21
PEP-115552CQ Human TRIM21 Peptide (TANPWLILSEDRRQVRLG) TRIM21
PEP-115545CQ Human TRIM21 Peptide (RQLANMVNNLKEISQEAR) TRIM21
PEP-115508CQ Human TRIM21 Peptide (FDSYPMVLGAQHFHSGKH) TRIM21
PEP-115507CQ Human TRIM21 Peptide (EVTCPICLDPFVEPVSIE) TRIM21
PEP-115501CQ Human TRIM21 Peptide (ELEKDEREQLRILGEKEA) TRIM21
PEP-115490CQ Human TRIM21 Peptide (APLTLCPLNIGSQGSTDY) TRIM21
PEP-115486CQ Human TRIM21 Peptide (HSSALELLQEVIIV) TRIM21
PEP-115474CQ Human TRIM21 Peptide (RADWKKTVETQKSRIHA) TRIM21
PEP-115473CQ Human TRIM21 Peptide (PQTPLHLQVPPCQVGIFLD) TRIM21
PEP-115470CQ Human TRIM21 Peptide (MASAARLTMMWEE) TRIM21
PEP-115466CQ Human TRIM21 Peptide (LDITSPELRSVCHVPGLK) TRIM21
PEP-115460CQ Human TRIM21 Peptide (GLKKMLRTCAVHITLD) TRIM21
PEP-013181CQ Human COP1 Peptide (SPSPPSVAV) COP1
PEP-013180CQ Human COP1 Peptide (HRWQIFQDW) COP1
PEP-013179CQ Human COP1 Peptide (RPSAGVGGSSSSL) COP1
PEP-013122CQ Human COMMD1 Peptide (KPLSGLLNAL) COMMD1
PEP-012755CQ Human COIL Peptide (TDNQRQQQL) COIL
PEP-012627CQ Human CNOT9 Peptide (ILLDDTGLAYI) CNOT9
PEP-012623CQ Human CNOT8 Peptide (RLYGLGTGV) CNOT8
PEP-012523CQ Human CMTR1 Peptide (WHAKGFGMTL) CMTR1
PEP-012506CQ Human CMPK1 Peptide (REMDQTMAA) CMPK1
PEP-012503CQ Human CMPK1 Peptide (SQYGELIEKY) CMPK1
PEP-012361CQ Human CLSPN Peptide (NEVETNAL) CLSPN
PEP-012350CQ Human CLSPN Peptide (RELEALKQRF) CLSPN
PEP-012313CQ Human CLP1 Peptide (YPHAFNVKF) CLP1
PEP-012309CQ Human CLNS1A Peptide (LSWLDGSGLGF) CLNS1A
PEP-012307CQ Human CLNS1A Peptide (SRLSWLDGSGLGF) CLNS1A
PEP-012298CQ Human CLK3 Peptide (RPPEVILEL) CLK3
PEP-012297CQ Human CLK3 Peptide (HEHHTTIVA) CLK3
PEP-012294CQ Human CLK3 Peptide (LEHVQLFDL) CLK3
PEP-012072CQ Human CIZ1 Peptide (FPQATRQSLL) CIZ1
PEP-012071CQ Human CIZ1 Peptide (EEWKGSETY) CIZ1
PEP-012068CQ Human CIZ1 Peptide (FPQATRQSL) CIZ1
PEP-012066CQ Human CIZ1 Peptide (ARNALTALF) CIZ1
PEP-012061CQ Human CITED2 Peptide (APAARFNNSQF) CITED2
PEP-012034CQ Human CIRBP Peptide (LEQVFSKY) CIRBP
PEP-012026CQ Human CIRBP Peptide (YSDRSSGGSYRDSY) CIRBP
PEP-012003CQ Human CIITA Peptide (RPRETRVIAV) CIITA
PEP-012002CQ Human CIITA Peptide (KLAEALPSL) CIITA
PEP-011997CQ Human CIITA Peptide (KRLQPGTLRAR) CIITA
PEP-011992CQ Human CIC Peptide (IRFTLPPGT) CIC
PEP-011991CQ Human CIC Peptide (TRFLPMDPATF) CIC
PEP-011951CQ Human CHTOP Peptide (NERFTNML) CHTOP
PEP-011535CQ Human CHFR Peptide (SPKGSGPSV) CHFR
PEP-011532CQ Human CHFR Peptide (STSGTVINK) CHFR
PEP-011524CQ Human CHEK2 Peptide (TYSKKHFRI) CHEK2
PEP-011519CQ Human CHEK1 Peptide (DRWYNKPL) CHEK1
PEP-011516CQ Human CHEK1 Peptide (FHAEPVDVW) CHEK1
PEP-011513CQ Human CHEK1 Peptide (ITIPDIKKDRW) CHEK1
PEP-011489CQ Human CHD7 Peptide (SRYPYSNLNQGL) CHD7
PEP-011488CQ Human CHD7 Peptide (SRTLYRIEL) CHD7
PEP-011486CQ Human CHD7 Peptide (RIGQSKSVK) CHD7
PEP-011480CQ Human CHD7 Peptide (IFDPVKQQF) CHD7
PEP-011465CQ Human CHD4 Peptide (IARIPPVAV) CHD4
PEP-011463CQ Human CHD4 Peptide (AEMEERFYRY) CHD4
PEP-011461CQ Human CHD4 Peptide (GQNKKVMIY) CHD4
PEP-011456CQ Human CHD4 Peptide (LEDFLEHEGYKY) CHD4
PEP-011446CQ Human CHD4 Peptide (SERNILSRL) CHD4
PEP-011442CQ Human CHD3 Peptide (RLLPSALGVK) CHD3
PEP-011437CQ Human CHD3 Peptide (ATNGPPVLVK) CHD3
PEP-011428CQ Human CHD2 Peptide (HRLKNDDSLLY) CHD2
PEP-011424CQ Human CHD2 Peptide (RSRQEPSRF) CHD2
PEP-011416CQ Human CHD1 Peptide (RPRTIPRENI) CHD1
PEP-011409CQ Human CHD1 Peptide (EEFETIERF) CHD1
PEP-011360CQ Human CHAF1A Peptide (FFVPHGYL) CHAF1A
PEP-011359CQ Human CHAF1A Peptide (VRPPQIKSL) CHAF1A
PEP-011355CQ Human CHAF1A Peptide (RPAFPVKKL) CHAF1A
PEP-011265CQ Human CFAP20 Peptide (KVRNGHIKR) CFAP20
PEP-011263CQ Human CFAP20 Peptide (YSEDELPAEFKLY) CFAP20
PEP-011248CQ Human CETN2 Peptide (KLFDDDETGKISF) CETN2
PEP-011131CQ Human CEP192 Peptide (HYINMPVQF) CEP192
PEP-011084CQ Human CENPS Peptide (RRSNSLLKY) CENPS
PEP-011080CQ Human CENPO Peptide (SEELQSVQA) CENPO
PEP-011067CQ Human CENPJ Peptide (KILERDQQICKG) CENPJ
PEP-011062CQ Human CENPH Peptide (ITTVIQHVF) CENPH
PEP-011061CQ Human CENPH Peptide (DRMRLSTAL) CENPH
PEP-011060CQ Human CENPH Peptide (DIRKKRLQL) CENPH
PEP-011051CQ Human CENPF Peptide (NELEQLKEAF) CENPF
PEP-011043CQ Human CENPF Peptide (KVREEIAEY) CENPF
PEP-011041CQ Human CENPF Peptide (EVKEISLDSY) CENPF
PEP-011036CQ Human CENPF Peptide (WQQKLTSV) CENPF
PEP-011034CQ Human CENPF Peptide (RVKETSNENLRL) CENPF
PEP-011033CQ Human CENPF Peptide (RVKETSNENLR) CENPF
PEP-011031CQ Human CENPF Peptide (QEVEDGKQKL) CENPF
PEP-011029CQ Human CENPF Peptide (KESEHHADLL) CENPF
(P): Predicted
* Abbreviations
IFImmunofluorescence
IHImmunohistochemistry
IPImmunoprecipitation
WBWestern Blot
EELISA
MMicroarray
CIChromatin Immunoprecipitation
FFlow Cytometry
FNFunction Assay
IDImmunodiffusion
RRadioimmunoassay
TCTissue Culture
GSGel Supershift
NNeutralization
BBlocking
AActivation
IInhibition
DDepletion
ESELISpot
DBDot Blot
MCMass Cytometry/CyTOF
CTCytotoxicity
SStimulation
AGAgonist
APApoptosis
IMImmunomicroscopy
BABioassay
CSCostimulation
EMElectron Microscopy
IEImmunoelectrophoresis
PAPeptide Array
ICImmunocytochemistry
PEPeptide ELISA
MDMeDIP
SHIn situ hybridization
IAEnzyme Immunoassay
SEsandwich ELISA
PLProximity Ligation Assay
ECELISA(Cap)
EDELISA(Det)
BIBioimaging
IOImmunoassay
LFLateral Flow Immunoassay
LALuminex Assay
CImmunohistochemistry-Frozen Sections
PImmunohistologyp-Paraffin Sections
ISIntracellular Staining for Flow Cytometry
MSElectrophoretic Mobility Shift Assay
RIRNA Binding Protein Immunoprecipitation (RIP)