|  

Results found for "signal transduction"

Loading...
Cat Product Name Target Host Antibody Isotype Cross Reactivity Clone Application* Inquiry
PEP-182591CQ Mouse MDH2 Peptide (TGRIQEAGTEVVKAKAGAG) MDH2
PEP-182587CQ Mouse MDH2 Peptide (RIQEAGTEVVKAKAGAG) MDH2
PEP-182582CQ Mouse MDH2 Peptide (NPVNSTIPITAEVFKK) MDH2
PEP-182581CQ Mouse MDH2 Peptide (IQEAGTEVVKAKAG) MDH2
PEP-182580CQ Mouse MDH2 Peptide (IQEAGTEVVKAK) MDH2
PEP-182578CQ Mouse MDH2 Peptide (GRIQEAGTEVVKAKAGA) MDH2
PEP-182577CQ Mouse MDH2 Peptide (GRIQEAGTEVVKAKAG) MDH2
PEP-182576CQ Mouse MDH2 Peptide (GRIQEAGTEVVKAKA) MDH2
PEP-182575CQ Mouse MDH2 Peptide (GRIQEAGTEVVKAK) MDH2
PEP-182573CQ Mouse SOD1 Peptide (HSIIGRTMVVHEKQD) SOD1
PEP-182512CQ Mouse COL3A1 Peptide (GAPGKNGERGGPGGPGL) COL3A1
PEP-182510CQ Mouse HSP90B1 Peptide (TEKESTEKDEL) HSP90B1
PEP-182508CQ Mouse HSP90B1 Peptide (KKTFEINPRHPLIR) HSP90B1
PEP-182506CQ Mouse HCK Peptide (DSGGFYISPRSTFSS) HCK
PEP-182487CQ Mouse PDIA4 Peptide (QAVDYDGSRTQEEIV) PDIA4
PEP-182483CQ Mouse HSP90AA1 Peptide (LRELISNSSDAL) HSP90AA1
PEP-182478CQ Mouse HSP90AA1 Peptide (SGKELHINLIPSK) HSP90AA1
PEP-182474CQ Mouse HSP90AA1 Peptide (KELHINLIPSKQ) HSP90AA1
PEP-182473CQ Mouse HSP90AA1 Peptide (DSGKELHINLIPSKQDRT) HSP90AA1
PEP-182472CQ Mouse HSP90AA1 Peptide (DSGKELHINLIPSKQDR) HSP90AA1
PEP-182337CQ Mouse ANXA2 Peptide (RDALNIETAVKTKGVD) ANXA2
PEP-182332CQ Mouse ANXA2 Peptide (FDAERDALNIETAVKTKGVDE) ANXA2
PEP-182321CQ Mouse ANXA2 Peptide (DAERDALNIETAVKTKGVD) ANXA2
PEP-182320CQ Mouse ANXA2 Peptide (DAERDALNIETAVKTKG) ANXA2
PEP-182316CQ Mouse CKM Peptide (VHVKLANL) CKM
PEP-182303CQ Mouse S100A4 Peptide (GKEGDKFKLNKTELK) S100A4
PEP-182301CQ Mouse S100A4 Peptide (EGDKFKLNKTELK) S100A4
PEP-182286CQ Mouse TNF Peptide (DKPVAHVVANHQVEE) TNF
PEP-182285CQ Mouse TNF Peptide (QLEWLSQRANALLA) TNF
PEP-182278CQ Mouse ENPP1 Peptide (SYYKSNSKL) ENPP1
PEP-182194CQ Mouse APOA4 Peptide (VPFVVQLSGHLAQE) APOA4
PEP-182186CQ Mouse APOA4 Peptide (QAQEQVQPKPLES) APOA4
PEP-182185CQ Mouse APOA4 Peptide (EQAQEQVQPKPLES) APOA4
PEP-182150CQ Mouse LDHA Peptide (SARFRYLMGERLG) LDHA
PEP-182145CQ Mouse LDHA Peptide (DSARFRYLMGERLG) LDHA
PEP-182142CQ Mouse LDHA Peptide (SAYEVIKL) LDHA
PEP-182129CQ Mouse TUBA1B Peptide (VPRAVFVDLEPTVIDE) TUBA1B
PEP-182126CQ Mouse TUBA1B Peptide (DIERPTYTNL) TUBA1B
PEP-182125CQ Mouse TUBA1B Peptide (SETGAGKHVPRAVFVDLEPTVIDEVRTGTY) TUBA1B
PEP-182121CQ Mouse GOT1 Peptide (TKNLDYVATSIHEAVT) GOT1
PEP-182118CQ Mouse GOT1 Peptide (NLDYVATSIHEAVTK) GOT1
PEP-182103CQ Mouse ALDOA Peptide (GRALQASALKAWGGKKEN) ALDOA
PEP-182098CQ Mouse ALDOA Peptide (ELSDIAHRI) ALDOA
PEP-182091CQ Mouse ALDOA Peptide (AAVYKALSDHHVY) ALDOA
PEP-181626CQ Mouse TGFB1 Peptide (KPKVEQLSNMIVRS) TGFB1
PEP-181521CQ Mouse INS2 Peptide (YLVCGERGFFYTPMS) INS2
PEP-181520CQ Mouse INS2 Peptide (GIVDQCCTSICSLYQ) INS2
PEP-181517CQ Mouse INS2 Peptide (EALYLVCGERG) INS2
PEP-181516CQ Mouse INS2 Peptide (YTPMSRREV) INS2
PEP-181503CQ Mouse INS2 Peptide (TLALEVAQQKRGIVDQ) INS2
PEP-181499CQ Mouse INS2 Peptide (MALWMRFLPLLALLF) INS2
PEP-181497CQ Mouse INS2 Peptide (LELGGGPGAGDLQTLALE) INS2
PEP-181496CQ Mouse INS2 Peptide (HPTQAFVKQHLCGSHL) INS2
PEP-181494CQ Mouse INS2 Peptide (FLPLLALLFLWESHPTQ) INS2
PEP-181492CQ Mouse INS2 Peptide (MALWMRFLP) INS2
PEP-181491CQ Mouse INS2 Peptide (VAQQKRGIVDQCCTSICSLY) INS2
PEP-181488CQ Mouse INS2 Peptide (MALWMRFLPLLALLFLWESHPTQA) INS2
PEP-181480CQ Mouse INS2 Peptide (GIVDQCCTSIC) INS2
PEP-181473CQ Mouse INS2 Peptide (WESHPTQAFVK) INS2
PEP-181471CQ Mouse INS2 Peptide (VEDPQVAQLEL) INS2
PEP-181470CQ Mouse INS2 Peptide (VEALYLVCGER) INS2
PEP-181466CQ Mouse INS2 Peptide (TSICSLYQLEN) INS2
PEP-181439CQ Mouse INS2 Peptide (LWESHPTQAFV) INS2
PEP-181429CQ Mouse INS2 Peptide (LALLFLWESHP) INS2
PEP-181424CQ Mouse INS2 Peptide (HPTQAFVKQHL) INS2
PEP-181423CQ Mouse INS2 Peptide (GPGAGDLQTLA) INS2
PEP-181421CQ Mouse INS2 Peptide (GGGPGAGDLQT) INS2
PEP-181416CQ Mouse INS2 Peptide (FVKQHLCGSHL) INS2
PEP-181414CQ Mouse INS2 Peptide (FLPLLALLFLW) INS2
PEP-181409CQ Mouse INS2 Peptide (ERGFFYTPMSR) INS2
PEP-181404CQ Mouse INS2 Peptide (CTSICSLYQLE) INS2
PEP-181399CQ Mouse INS2 Peptide (ALWMRFLPLLA) INS2
PEP-181391CQ Mouse INS1 Peptide (SPGDLQTLAL) INS1
PEP-181388CQ Mouse INS1 Peptide (FLPLLALLALWEPKPTQA) INS1
PEP-181385CQ Mouse INS1 Peptide (YLVCGERGFFYTPKSRR) INS1
PEP-181384CQ Mouse INS1 Peptide (VKQHLCGPHLVEALYL) INS1
PEP-181383CQ Mouse INS1 Peptide (VARQKRGIVDQCCTSICSLY) INS1
PEP-181381CQ Mouse INS1 Peptide (SRREVEDPQVEQLELGGSPG) INS1
PEP-181379CQ Mouse INS1 Peptide (RGFFYTPKSRREVED) INS1
PEP-181377CQ Mouse INS1 Peptide (PQVEQLELGGSPGDLQ) INS1
PEP-181375CQ Mouse INS1 Peptide (MALLVHFLPLLALLA) INS1
PEP-181373CQ Mouse INS1 Peptide (LELGGSPGDLQTLALE) INS1
PEP-181372CQ Mouse INS1 Peptide (LALWEPKPTQAFVKQHLCGP) INS1
PEP-181371CQ Mouse INS1 Peptide (LALWEPKPTQAFVKQHL) INS1
PEP-181364CQ Mouse INS1 Peptide (AFVKQHLCGPHLVEALYLVC) INS1
PEP-181361CQ Mouse INS1 Peptide (GDLQTLALEVARQ) INS1
PEP-181356CQ Mouse INS1 Peptide (VKQHLCGPHLV) INS1
PEP-181350CQ Mouse INS1 Peptide (TPKSRREVEDP) INS1
PEP-181347CQ Mouse INS1 Peptide (SPGDLQTLALE) INS1
PEP-181345CQ Mouse INS1 Peptide (RREVEDPQVEQ) INS1
PEP-181343CQ Mouse INS1 Peptide (RGFFYTPKSRR) INS1
PEP-181341CQ Mouse INS1 Peptide (QVEQLELGGSP) INS1
PEP-181337CQ Mouse INS1 Peptide (QAFVKQHLCGP) INS1
PEP-181334CQ Mouse INS1 Peptide (PLLALLALWEP) INS1
PEP-181332CQ Mouse INS1 Peptide (PKPTQAFVKQH) INS1
PEP-181331CQ Mouse INS1 Peptide (PHLVEALYLVC) INS1
PEP-181320CQ Mouse INS1 Peptide (LEVARQKRGIV) INS1
PEP-181317CQ Mouse INS1 Peptide (LALWEPKPTQA) INS1
PEP-181316CQ Mouse INS1 Peptide (LALLALWEPKP) INS1
PEP-181312CQ Mouse INS1 Peptide (KQHLCGPHLVE) INS1
(P): Predicted
* Abbreviations
IFImmunofluorescence
IHImmunohistochemistry
IPImmunoprecipitation
WBWestern Blot
EELISA
MMicroarray
CIChromatin Immunoprecipitation
FFlow Cytometry
FNFunction Assay
IDImmunodiffusion
RRadioimmunoassay
TCTissue Culture
GSGel Supershift
NNeutralization
BBlocking
AActivation
IInhibition
DDepletion
ESELISpot
DBDot Blot
MCMass Cytometry/CyTOF
CTCytotoxicity
SStimulation
AGAgonist
APApoptosis
IMImmunomicroscopy
BABioassay
CSCostimulation
EMElectron Microscopy
IEImmunoelectrophoresis
PAPeptide Array
ICImmunocytochemistry
PEPeptide ELISA
MDMeDIP
SHIn situ hybridization
IAEnzyme Immunoassay
SEsandwich ELISA
PLProximity Ligation Assay
ECELISA(Cap)
EDELISA(Det)
BIBioimaging
IOImmunoassay
LFLateral Flow Immunoassay
LALuminex Assay
CImmunohistochemistry-Frozen Sections
PImmunohistologyp-Paraffin Sections
ISIntracellular Staining for Flow Cytometry
MSElectrophoretic Mobility Shift Assay
RIRNA Binding Protein Immunoprecipitation (RIP)