Sign in or Register   Sign in or Register
  |  

Mouse Anti-DICER1 Recombinant Antibody (CL0378) (CBMAB-D0904-YC)

Provided herein is a Mouse monoclonal antibody, which binds to Dicer 1, Ribonuclease III (DICER1). The antibody can be used for immunoassay techniques, such as WB, IHC-Fr, ICC, IF, IHC-P.
See all DICER1 antibodies

Summary

Host Animal
Mouse
Specificity
Human
Clone
CL0378
Antibody Isotype
IgG2a
Application
WB, IHC-Fr, ICC, IF, IHC-P

Basic Information

Immunogen
A recombinant protein corresponding to amino acids: PTDADSAYCVLPLNVVNDSSTLDIDFKFMEDIEKSEARIGIPSTKYTKETPFVFKLEDYQDAVIIPRYRNFDQPHRFYVADVYTDLTPLSKFPSPEYETFAEYYKTKYNLDLTNLNQPLLDVDHTSSRLNLLTPRHLNQKGKALPLSSAEKRKAKWESLQNKQILVPELCAIHPIPASLWRKAVCLPSILYRLH
Specificity
Human
Antibody Isotype
IgG2a
Clonality
Monoclonal
Application Notes
The COA includes recommended starting dilutions, optimal dilutions should be determined by the end user.

Formulations & Storage [For reference only, actual COA shall prevail!]

Storage
Store at 4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze/thaw cycles.

Target

Full Name
Dicer 1, Ribonuclease III
Introduction
DICER1 is a protein possessing an RNA helicase motif containing a DEXH box in its amino terminus and an RNA motif in the carboxy terminus. The encoded protein functions as a ribonuclease and is required by the RNA interference and small temporal RNA (stRNA) pathways to produce the active small RNA component that represses gene expression.
Entrez Gene ID
23405
UniProt ID
Q9UPY3
Alternative Names
Dicer 1, Ribonuclease III; Dicer 1, Double-Stranded RNA-Specific Endoribonuclease; Dicer 1, Ribonuclease Type III; Helicase MOI; EC 3.1.26.3; Dicer; HERNA; Dicer1, Dcr-1 Homolog (Drosophila); Helicase With RNAse Motif; Helicase With RNase Motif; Endoribonuclease Dicer;
Function
Double-stranded RNA (dsRNA) endoribonuclease playing a central role in short dsRNA-mediated post-transcriptional gene silencing. Cleaves naturally occurring long dsRNAs and short hairpin pre-microRNAs (miRNA) into fragments of twenty-one to twenty-three nucleotides with 3' overhang of two nucleotides, producing respectively short interfering RNAs (siRNA) and mature microRNAs. SiRNAs and miRNAs serve as guide to direct the RNA-induced silencing complex (RISC) to complementary RNAs to degrade them or prevent their translation. Gene silencing mediated by siRNAs, also called RNA interference, controls the elimination of transcripts from mobile and repetitive DNA elements of the genome but also the degradation of exogenous RNA of viral origin for instance. The miRNA pathway on the other side is a mean to specifically regulate the expression of target genes.
Biological Process
Apoptotic DNA fragmentation Source: GO_Central
Conversion of ds siRNA to ss siRNA Source: AgBase
Conversion of ds siRNA to ss siRNA involved in RNA interference Source: BHF-UCL
miRNA loading onto RISC involved in gene silencing by miRNA Source: BHF-UCL
miRNA metabolic process Source: Reactome
Negative regulation of gene expression Source: ARUK-UCL
Negative regulation of Schwann cell proliferation Source: BHF-UCL
Negative regulation of transcription by RNA polymerase II Source: BHF-UCL
Negative regulation of tumor necrosis factor production Source: ARUK-UCL
Nerve development Source: BHF-UCL
Neuron projection morphogenesis Source: BHF-UCL
NIK/NF-kappaB signaling Source: ARUK-UCL
Peripheral nervous system myelin formation Source: BHF-UCL
Positive regulation of myelination Source: BHF-UCL
Positive regulation of Schwann cell differentiation Source: BHF-UCL
Pre-miRNA processing Source: UniProtKB
Production of miRNAs involved in gene silencing by miRNA Source: UniProtKB
Production of siRNA involved in RNA interference Source: UniProtKB
RNA phosphodiester bond hydrolysis Source: GO_Central
RNA phosphodiester bond hydrolysis, endonucleolytic Source: BHF-UCL
siRNA loading onto RISC involved in RNA interference Source: BHF-UCL
Targeting of mRNA for destruction involved in RNA interference Source: UniProtKB
tRNA catabolic process Source: Reactome
Cellular Location
Cytoplasm; Perinuclear region
Involvement in disease
Pleuropulmonary blastoma (PPB):
A rare pediatric intrathoracic neoplasm. The tumor arises from the lung, pleura, or both, and appears to be purely mesenchymal in phenotype. It lacks malignant epithelial elements, a feature that distinguishes it from the classic adult-type pulmonary blastoma. It arises during fetal lung development and is often part of an inherited cancer syndrome. The tumor contain both epithelial and mesenchymal cells. Early in tumorigenesis, cysts form in lung airspaces, and these cysts are lined with benign-appearing epithelium. Mesenchymal cells susceptible to malignant transformation reside within the cyst walls and form a dense layer beneath the epithelial lining. In a subset of patients, overgrowth of the mesenchymal cells produces a sarcoma, a transition that is associated with a poorer prognosis. Some patients have multilocular cystic nephroma, a benign kidney tumor.
Goiter multinodular 1, with or without Sertoli-Leydig cell tumors (MNG1):
A common disorder characterized by nodular overgrowth of the thyroid gland. Some individuals may also develop Sertoli-Leydig cell tumors, usually of the ovary.
Rhabdomyosarcoma, embryonal, 2 (RMSE2):
A form of rhabdomyosarcoma, a highly malignant tumor of striated muscle derived from primitive mesenchymal cells and exhibiting differentiation along rhabdomyoblastic lines. Rhabdomyosarcoma is one of the most frequently occurring soft tissue sarcomas and the most common in children. It occurs in four forms: alveolar, pleomorphic, embryonal and botryoidal rhabdomyosarcomas.
Global developmental delay, lung cysts, overgrowth, and Wilms tumor (GLOW):
A disease characterized by the association of congenital nephromegaly, bilateral Wilms tumor, somatic overgrowth, developmental delay, macrocephaly, and bilateral lung cysts.
DICER1 mutations have been found in uterine cervix embryonal rhabdomyosarcoma, primitive neuroectodermal tumor, Wilms tumor, pulmonary sequestration and juvenile intestinal polyp (PubMed:21882293). Somatic missense mutations affecting the RNase IIIb domain of DICER1 are common in non-epithelial ovarian tumors. These mutations do not abolish DICER1 function but alter it in specific cell types, a novel mechanism through which perturbation of microRNA processing may be oncogenic (PubMed:22187960).

Lee, M., Jang, S. J., Cho, K. J., Lee, S. M., Kim, H. R., & Song, J. S. (2021). Pleuropulmonary blastoma with hotspot mutations in RNase IIIb domain of DICER 1: clinicopathologic study of 10 cases in a single-institute experience. Pathobiology, 88(3), 251-260.

Canberk, S., Ferreira, J. C., Pereira, L., Batısta, R., Vieira, A. F., Soares, P., ... & Máximo, V. (2021). Analyzing the role of DICER1 germline variations in papillary thyroid carcinoma. European thyroid journal, 9(6), 296-303.

Venger, K., Elbracht, M., Carlens, J., Deutz, P., Zeppernick, F., Lassay, L., ... & Kontny, U. (2021). Unusual phenotypes in patients with a pathogenic germline variant in DICER1. Familial cancer, 1-6.

Tadepalli, S. H., Shields, C. L., Shields, J. A., & Honavar, S. G. (2019). Intraocular medulloepithelioma–A review of clinical features, DICER 1 mutation, and management. Indian journal of ophthalmology, 67(6), 755.

Liao, C. C., Ho, M. Y., Liang, S. M., & Liang, C. M. (2018). Autophagic degradation of SQSTM1 inhibits ovarian cancer motility by decreasing DICER1 and AGO2 to induce MIRLET7A-3P. Autophagy, 14(12), 2065-2082.

Abbo, O., Pinnagoda, K., Brouchet, L., Leobon, B., Savagner, F., Oliver, I., ... & Pasquet, M. (2018). Wilms tumor, pleuropulmonary blastoma, and DICER1: case report and literature review. World Journal of Surgical Oncology, 16(1), 1-4.

Solarski, M., Rotondo, F., Foulkes, W. D., Priest, J. R., Syro, L. V., Butz, H., ... & Kovacs, K. (2018). DICER1 gene mutations in endocrine tumors. Endocrine-related cancer, 25(3), R197-R208.

Robertson, J. C., Jorcyk, C. L., & Oxford, J. T. (2018). DICER1 syndrome: DICER1 mutations in rare cancers. Cancers, 10(5), 143.

Caimari, F., Kumar, A. V., Kurzawinski, T., Butler, G., Sabbaghian, N., Foulkes, W. D., & Korbonits, M. (2018). A novel DICER1 mutation in familial multinodular goitre. Clin Endocrinol (Oxf).

Vanecek, T., Pivovarcikova, K., Pitra, T., Peckova, K., Rotterova, P., Daum, O., ... & Hes, O. (2017). Mixed epithelial and stromal tumor of the kidney: mutation analysis of the DICER 1 gene in 29 cases. Applied immunohistochemistry & molecular morphology, 25(2), 117-121.

Ask a question We look forward to hearing from you.
0 reviews or Q&As

Purchasing FAQs
Technical FAQs

Loading...
Have you used Mouse Anti-DICER1 Recombinant Antibody (CL0378)?
Submit a review and get a Coupon or an Amazon gift card. 20% off Coupon $30 eGift Card
Submit a review
Loading...
For research use only. Not intended for any clinical use.

Custom Antibody Labeling

We also offer labeled antibodies developed using our catalog antibody products and nonfluorescent conjugates (HRP, AP, Biotin, etc.) or fluorescent conjugates (Alexa Fluor, FITC, TRITC, Rhodamine, Texas Red, R-PE, APC, Qdot Probes, Pacific Dyes, etc.).

Online Inquiry

Documents

Contact us

  • Tel: (USA)
  • (UK)
  • Fax:
  • Email:

Submit A Review

Go to
Compare