Sign in or Register   Sign in or Register
  |  

Mouse Anti-CA12 Recombinant Antibody (CBXC-1869) (CBMAB-C3717-CQ)

This product is a mouse antibody that recognizes CA12. The antibody CBXC-1869 can be used for immunoassay techniques such as: WB, IHC, IHC-P.
See all CA12 antibodies

Summary

Host Animal
Mouse
Specificity
Human
Clone
CBXC-1869
Antibody Isotype
IgG2a
Application
WB, IHC, IHC-P

Basic Information

Immunogen
Recombinant protein corresponding to amino acids: TASNKSEGLAVLAVLIEMGSFNPSYDKIFSHLQHVKYKGQEAFVPGFNIEELLPERTAEYYRYRGSLTTPPCNPTVLWTVFRNPVQISQEQLLALETALYCTHMDDPSPREMINNFRQVQ
Specificity
Human
Antibody Isotype
IgG2a
Application Notes
The COA includes recommended starting dilutions, optimal dilutions should be determined by the end user.

Formulations & Storage [For reference only, actual COA shall prevail!]

Storage
Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze/thaw cycles.

Target

Full Name
Carbonic Anhydrase 12
Introduction
Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. This gene product is a type I membrane protein that is highly expressed in normal tissues, such as kidney, colon and pancreas, and has been found to be overexpressed in 10% of clear cell renal carcinomas. Three transcript variants encoding different isoforms have been identified for this gene.
Entrez Gene ID
UniProt ID
Alternative Names
Carbonic Anhydrase 12; Carbonic Anhydrase XII; Tumor Antigen HOM-RCC-3.1.3; Carbonate Dehydratase XII; CA-XII; Carbonic Dehydratase;
Function
Reversible hydration of carbon dioxide.
Biological Process
Bicarbonate transport Source: Reactome
Chloride ion homeostasis Source: UniProtKB
One-carbon metabolic process Source: GO_Central
Cellular Location
Cell membrane; Membrane
Involvement in disease
Hyperchlorhidrosis, isolated (HYCHL): An autosomal recessive disorder characterized by excessive sweating and increased sweat chloride levels. Affected individuals suffer from episodes of hyponatremic dehydration and report increased amounts of visible salt precipitates in sweat.
Topology
Extracellular: 25-301 aa
Helical: 302-322 aa
Cytoplasmic: 323-354 aa

Li, G., Chen, T. W., Nickel, A. C., Muhammad, S., Steiger, H. J., Tzaridis, T., ... & Kahlert, U. D. (2021). Carbonic Anhydrase XII is a Clinically Significant, Molecular Tumor-Subtype Specific Therapeutic Target in Glioma with the Potential to Combat Invasion of Brain Tumor Cells. OncoTargets and therapy, 14, 1707.

Zhao, X., Shen, P., Li, H., Yang, Y., Guo, J., Chen, S., ... & Fang, X. (2020). Carbonic Anhydrase 12 Protects Endplate Cartilage From Degeneration Regulated by IGF-1/PI3K/CREB Signaling Pathway. Frontiers in cell and developmental biology, 8, 1123.

Franke, C. M., Gu, V. W., Grimm, B. G., Cassady, V. C., White, J. R., Weigel, R. J., & Kulak, M. V. (2020). TFAP2C regulates carbonic anhydrase XII in human breast cancer. Oncogene, 39(6), 1290-1301.

Hwang, S., Kang, J. Y., Kim, M. J., Shin, D. M., & Hong, J. H. (2019). Carbonic anhydrase 12 mutation modulates membrane stability and volume regulation of aquaporin 5. Journal of enzyme inhibition and medicinal chemistry, 34(1), 179-188.

Li, Y., Lei, B., Zou, J., Wang, W., Chen, A., Zhang, J., ... & Li, Z. (2019). High expression of carbonic anhydrase 12 (CA12) is associated with good prognosis in breast cancer. Neoplasma, 66(3), 420-426.

Uda, N. R., Stenner, F., Seibert, V., Herzig, P., Markuly, N., Van Dijk, M., ... & Renner, C. (2019). Humanized monoclonal antibody blocking carbonic anhydrase 12 enzymatic activity leads to reduced tumor growth in vitro. Anticancer research, 39(8), 4117-4128.

Hwang, S., Shin, D. M., & Hong, J. H. (2019). Drug Repurposing as an Antitumor Agent: Disulfiram-Mediated Carbonic Anhydrase 12 and Anion Exchanger 2 Modulation to Inhibit Cancer Cell Migration. Molecules, 24(18), 3409.

Avital, D., Hershkovitz, E., & Loewenthal, N. (2018). Exertional rhabdomyolysis in carbonic anhydrase 12 deficiency. Journal of Pediatric Endocrinology and Metabolism, 31(6), 697-699.

Ask a question We look forward to hearing from you.
0 reviews or Q&As
Loading...
Have you used Mouse Anti-CA12 Recombinant Antibody (CBXC-1869)?
Submit a review and get a Coupon or an Amazon gift card. 20% off Coupon $30 eGift Card
Submit a review
Loading...
For research use only. Not intended for any clinical use.

Custom Antibody Labeling

We also offer labeled antibodies developed using our catalog antibody products and nonfluorescent conjugates (HRP, AP, Biotin, etc.) or fluorescent conjugates (Alexa Fluor, FITC, TRITC, Rhodamine, Texas Red, R-PE, APC, Qdot Probes, Pacific Dyes, etc.).

Online Inquiry

Documents

Contact us

  • Tel: (USA)
  • (UK)
  • Fax:
  • Email:

Submit A Review

Go to
Compare