Sign in or Register   Sign in or Register
  |  

Mouse Anti-OCLN Recombinant Antibody (CBXO-0512) (CBMAB-O0241-CQ)

This product is a mouse antibody that recognizes OCLN. The antibody CBXO-0512 can be used for immunoassay techniques such as: WB, IHC, IHC-P.
See all OCLN antibodies

Summary

Host Animal
Mouse
Specificity
Human
Clone
CBXO-0512
Antibody Isotype
IgG2a
Application
WB, IHC, IHC-P

Basic Information

Immunogen
Recombinant protein corresponding to amino acids: DKEHIYDEQPPNVEEWVKNVSAGTQDVPSPPSDYVERVDSPMAYSSNGKVNDKRFYPESSYKSTPVPEVVQELPLTSPVDDFRQPRYSSGGNFETPSKRAPAKGRAGRSKRTEQDHYETDYTTGGESCDELEED
Specificity
Human
Antibody Isotype
IgG2a
Application Notes
The COA includes recommended starting dilutions, optimal dilutions should be determined by the end user.

Formulations & Storage [For reference only, actual COA shall prevail!]

Format
Liquid
Storage
Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze/thaw cycles.

Target

Full Name
Occludin
Introduction
This gene encodes an integral membrane protein that is required for cytokine-induced regulation of the tight junction paracellular permeability barrier. Mutations in this gene are thought to be a cause of band-like calcification with simplified gyration and polymicrogyria (BLC-PMG), an autosomal recessive neurologic disorder that is also known as pseudo-TORCH syndrome. Alternative splicing results in multiple transcript variants. A related pseudogene is present 1.5 Mb downstream on the q arm of chromosome 5.
Entrez Gene ID
UniProt ID
Alternative Names
Occludin; Phosphatase 1, Regulatory Subunit 115; Tight Junction Protein Occludin TM4 Minus; Tight Junction Protein Occludin; PPP1R115; PTORCH1; BLCPMG
Function
May play a role in the formation and regulation of the tight junction (TJ) paracellular permeability barrier. It is able to induce adhesion when expressed in cells lacking tight junctions.
(Microbial infection) Acts as a coreceptor for hepatitis C virus (HCV) in hepatocytes.
Biological Process
Bicellular tight junction assemblyManual Assertion Based On ExperimentIMP:UniProtKB
Cell-cell junction organizationManual Assertion Based On ExperimentIMP:MGI
Maintenance of blood-brain barrier1 PublicationNAS:ARUK-UCL
Negative regulation of gene expressionManual Assertion Based On ExperimentIMP:ARUK-UCL
Negative regulation of protein phosphorylationManual Assertion Based On ExperimentIMP:ARUK-UCL
Positive regulation of blood-brain barrier permeabilityManual Assertion Based On ExperimentIMP:ARUK-UCL
Positive regulation of gene expressionManual Assertion Based On ExperimentIMP:ARUK-UCL
Positive regulation of glucose importManual Assertion Based On ExperimentIMP:ARUK-UCL
Positive regulation of lamellipodium assemblyISS:ARUK-UCL
Positive regulation of microtubule polymerizationISS:ARUK-UCL
Positive regulation of wound healingISS:ARUK-UCL
Protein localization to cell leading edgeISS:ARUK-UCL
Protein-containing complex assemblyManual Assertion Based On ExperimentTAS:ProtInc
Regulation of glucose transmembrane transportManual Assertion Based On ExperimentIMP:ARUK-UCL
Cellular Location
Cell membrane
Cell junction, tight junction
Involvement in disease
Pseudo-TORCH syndrome 1 (PTORCH1):
An autosomal recessive neurologic disorder with characteristic clinical and neuroradiologic features that mimic intrauterine TORCH infection in the absence of evidence of infection. Affected individuals have congenital microcephaly, intracranial calcifications, and severe developmental delay.
Topology
Cytoplasmic: 1-66
Helical: 67-89
Extracellular: 90-135
Helical: 136-160
Cytoplasmic: 161-170
Helical: 171-195
Extracellular: 196-243
Helical: 244-265
Cytoplasmic: 266-522
PTM
Dephosphorylated by PTPRJ. The tyrosine phosphorylation on Tyr-398 and Tyr-402 reduces its ability to interact with TJP1. Phosphorylation at Ser-490 also attenuates the interaction with TJP1.

Zhang, J., Yang, W., Roy, S., Liu, H., Roberts, R. M., Wang, L., ... & Ma, W. (2023). Tight junction protein occludin is an internalization factor for SARS-CoV-2 infection and mediates virus cell-to-cell transmission. Proceedings of the National Academy of Sciences, 120(17), e2218623120.

Kuo, W. T., Odenwald, M. A., Turner, J. R., & Zuo, L. (2022). Tight junction proteins occludin and ZO‐1 as regulators of epithelial proliferation and survival. Annals of the New York Academy of Sciences, 1514(1), 21-33.

Yang, F., Liu, X. Q., He, J. Z., Xian, S. P., Yang, P. F., Mai, Z. Y., ... & Zhang, X. D. (2022). Occludin facilitates tumour angiogenesis in bladder cancer by regulating IL8/STAT3 through STAT4. Journal of Cellular and Molecular Medicine, 26(8), 2363-2376.

Hou, Q., Huang, Y., Wang, Y., Liao, L., Zhu, Z., Zhang, W., ... & Liu, F. (2020). Lactobacillus casei LC01 regulates intestinal epithelial permeability through miR-144 targeting of OCLN and ZO1. Journal of Microbiology and Biotechnology, 30(10), 1480.

Zhou, T., Lu, Y., Xu, C., Wang, R., Zhang, L., & Lu, P. (2020). Occludin protects secretory cells from ER stress by facilitating SNARE-dependent apical protein exocytosis. Proceedings of the National Academy of Sciences, 117(9), 4758-4769.

Lavie, M., Linna, L., Moustafa, R. I., Belouzard, S., Fukasawa, M., & Dubuisson, J. (2019). Role of the cytosolic domain of occludin in trafficking and hepatitis C virus infection. Traffic, 20(10), 753-773.

Bendriem, R. M., Singh, S., Aleem, A. A., Antonetti, D. A., & Ross, M. E. (2019). Tight junction protein occludin regulates progenitor Self-Renewal and survival in developing cortex. Elife, 8, e49376.

Shimizu, Y., Shirasago, Y., Suzuki, T., Hata, T., Kondoh, M., Hanada, K., ... & Fukasawa, M. (2019). Characterization of monoclonal antibodies recognizing each extracellular loop domain of occludin. The journal of biochemistry, 166(4), 297-308.

Lavie, M., Linna, L., Moustafa, R. I., Belouzard, S., Fukasawa, M., & Dubuisson, J. (2019). Role of the cytosolic domain of occludin in trafficking and HCV infection 1 Running Title: OCLN C-terminus and HCV entry 2. Traffic.

Ask a question We look forward to hearing from you.
0 reviews or Q&As
Loading...
Have you used Mouse Anti-OCLN Recombinant Antibody (CBXO-0512)?
Submit a review and get a Coupon or an Amazon gift card. 20% off Coupon $30 eGift Card
Submit a review
Loading...
For research use only. Not intended for any clinical use.

Custom Antibody Labeling

We also offer labeled antibodies developed using our catalog antibody products and nonfluorescent conjugates (HRP, AP, Biotin, etc.) or fluorescent conjugates (Alexa Fluor, FITC, TRITC, Rhodamine, Texas Red, R-PE, APC, Qdot Probes, Pacific Dyes, etc.).

Online Inquiry

Documents

Contact us

  • Tel: (USA)
  • (UK)
  • Fax:
  • Email:

Submit A Review

Go to
Compare