Sign in or Register   Sign in or Register
  |  

Mouse Anti-CDK5RAP2 Recombinant Antibody (CL3392) (CBMAB-1345-CN)

This product is a mouse antibody that recognizes CDK5RAP2 of human. The antibody CL3392 can be used for immunoassay techniques such as: IF, IHC-P.
See all CDK5RAP2 antibodies

Summary

Host Animal
Mouse
Specificity
Human
Clone
CL3392
Antibody Isotype
IgG1
Application
IF, IHC-P

Basic Information

Immunogen
Recombinant fragment corresponding to Human CDK5RAP2 aa. 1307-1387.
Sequence: ELLEKLEKLFLNGKSVGVEMNTQNELMERIEEDNLTYQHLLPESPEPSASHALSDYETSEKSFFSRDQKQDNETEKTSVMV
Specificity
Human
Antibody Isotype
IgG1
Clonality
Monoclonal
Application Notes
The COA includes recommended starting dilutions, optimal dilutions should be determined by the end user.

Formulations & Storage [For reference only, actual COA shall prevail!]

Format
Liquid
Buffer
59% PBS, 40% Glycerol, pH 7.2
Preservative
0.02% Sodium Azide
Concentration
0.5 mg/mL
Storage
Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze/thaw cycles.
Epitope
Located within the peptide sequence YETSEKSFFS

Target

Full Name
CDK5 Regulatory Subunit Associated Protein 2
Introduction
This gene encodes a regulator of CDK5 (cyclin-dependent kinase 5) activity. The protein encoded by this gene is localized to the centrosome and Golgi complex, interacts with CDK5R1 and pericentrin (PCNT), plays a role in centriole engagement and microtubule nucleation, and has been linked to primary microcephaly and Alzheimer's disease. Potential regulator of CDK5 activity via its interaction with CDK5R1. It regulates centrosomal maturation by recruitment of the gamma-tubulin ring complex (gamma-TuRC) onto centrosomes (PubMed:26485573).
Entrez Gene ID
UniProt ID
Alternative Names
C48; MCPH3; Cep215
Function
Potential regulator of CDK5 activity via its interaction with CDK5R1. Negative regulator of centriole disengagement (licensing) which maintains centriole engagement and cohesion. Involved in regulation of mitotic spindle orientation (By similarity).
Plays a role in the spindle checkpoint activation by acting as a transcriptional regulator of both BUBR1 and MAD2 promoter. Together with EB1/MAPRE1, may promote microtubule polymerization, bundle formation, growth and dynamics at the plus ends. Regulates centrosomal maturation by recruitment of the gamma-tubulin ring complex (gamma-TuRC) onto centrosomes (PubMed:26485573).
In complex with PDE4DIP isoform 13/MMG8/SMYLE, MAPRE1 and AKAP9, contributes to microtubules nucleation and extension from the centrosome to the cell periphery (PubMed:29162697).
Required for the recruitment of AKAP9 to centrosomes (PubMed:29162697).
Plays a role in neurogenesis (By similarity).
Biological Process
Brain development Source: UniProtKB
Centriole replication Source: UniProtKB
Centrosome cycle Source: UniProtKB
Chromosome segregation Source: UniProtKB
Ciliary basal body-plasma membrane docking Source: Reactome
Establishment of mitotic spindle orientation Source: UniProtKB
G2/M transition of mitotic cell cycle Source: Reactome
Microtubule bundle formation Source: UniProtKB
Microtubule cytoskeleton organization Source: UniProtKB
Microtubule organizing center organization Source: UniProtKB
Negative regulation of centriole replication Source: UniProtKB
Negative regulation of neuron differentiation Source: Ensembl
Neurogenesis Source: UniProtKB
Positive regulation of microtubule polymerization Source: UniProtKB
Positive regulation of transcription, DNA-templated Source: UniProtKB
Regulation of G2/M transition of mitotic cell cycle Source: Reactome
Regulation of mitotic cell cycle spindle assembly checkpoint Source: UniProtKB
Regulation of neuron differentiation Source: UniProtKB
Cellular Location
Cytoplasm; Golgi apparatus; Centrosome; Cytoskeleton. Found in the pericentriolar region adhering to the surface of the centrosome and in the region of the centrosomal appendages. Localizes to microtubule plus ends in the presence of EB1/MAPRE1. Localization to centrosomes versus Golgi apparatus may be cell type-dependent. For instance, in SK-BR-3 and HEK293F cells, localizes to centrosomes but not to the Golgi apparatus (PubMed:29162697).
Involvement in disease
Microcephaly 3, primary, autosomal recessive (MCPH3): A disease defined as a head circumference more than 3 standard deviations below the age-related mean. Brain weight is markedly reduced and the cerebral cortex is disproportionately small. Despite this marked reduction in size, the gyral pattern is relatively well preserved, with no major abnormality in cortical architecture. Affected individuals are mentally retarded. Primary microcephaly is further defined by the absence of other syndromic features or significant neurological deficits due to degenerative brain disorder.
PTM
Phosphorylated in vitro by CDK5.
Ask a question We look forward to hearing from you.
0 reviews or Q&As
Loading...
Have you used Mouse Anti-CDK5RAP2 Recombinant Antibody (CL3392)?
Submit a review and get a Coupon or an Amazon gift card. 20% off Coupon $30 eGift Card
Submit a review
Loading...
For research use only. Not intended for any clinical use.

Custom Antibody Labeling

We also offer labeled antibodies developed using our catalog antibody products and nonfluorescent conjugates (HRP, AP, Biotin, etc.) or fluorescent conjugates (Alexa Fluor, FITC, TRITC, Rhodamine, Texas Red, R-PE, APC, Qdot Probes, Pacific Dyes, etc.).

Online Inquiry

Documents

Contact us

  • Tel: (USA)
  • (UK)
  • Fax:
  • Email:

Submit A Review

Go to
Compare