Mouse Anti-ABCC9 Recombinant Antibody (V2-179047) (CBMAB-A0283-YC)

Name: Mouse Anti-ABCC9 Recombinant Antibody (V2-179047)
SKU: CBMAB-A0283-YC
Rating: 5 (1 reviews)

See all ABCC9 antibodies

Online Inquiry

Datasheet

Summary

Host Animal

Mouse

Specificity

Mouse

Clone

V2-179047

Antibody Isotype

IgG2a

Application

WB, IHC, ICC, IF

Basic Information

Immunogen

Fusion protein amino acids 1505-1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A

Specificity

Mouse

Antibody Isotype

IgG2a

Clonality

Monoclonal

Application Notes

The COA includes recommended starting dilutions, optimal dilutions should be determined by the end user.

Application	Note
WB	1:1,000

Formulations & Storage [For reference only, actual COA shall prevail!]

Buffer

PBS, pH7.4, 50% Glycerol

Preservative

0.09% sodium azide

Concentration

1 mg/ml

Storage

Store at 4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze/thaw cycles.

Target

Full Name

ATP-binding cassette, sub-family C (CFTR/MRP), member 9

Introduction

ABCC9 is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN

Entrez Gene ID

20928

UniProt ID

P70170

Alternative Names

ATP Binding Cassette Subfamily C Member 9; Sulfonylurea Receptor 2; ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 9; SUR2; ATP-Binding Cassette Transporter Sub-Family C Member 9; ATP-Binding Cassette Sub-Family C Member 9;

Function

Subunit of ATP-sensitive potassium channels (KATP). Can form cardiac and smooth muscle-type KATP channels with KCNJ11. KCNJ11 forms the channel pore while ABCC9 is required for activation and regulation.

Biological Process

Cardiac conduction
Cation transmembrane transport
Defense response to virus
Inorganic cation transmembrane transport
Potassium ion import across plasma membrane
Potassium ion transmembrane transport
Regulation of cardiac conduction
Response to ATP
Transmembrane transport
Transport across blood-brain barrier

Cellular Location

Membrane

Involvement in disease

A disorder characterized by ventricular dilation and impaired systolic function, resulting in congestive heart failure and arrhythmia. Patients are at risk of premature death.
A familial form of atrial fibrillation, a common sustained cardiac rhythm disturbance. Atrial fibrillation is characterized by disorganized atrial electrical activity and ineffective atrial contraction promoting blood stasis in the atria and reduces ventricular filling. It can result in palpitations, syncope, thromboembolic stroke, and congestive heart failure.
A rare disorder characterized by congenital hypertrichosis, neonatal macrosomia, a distinct osteochondrodysplasia, and cardiomegaly. The hypertrichosis leads to thick scalp hair, which extends onto the forehead, and a general increase in body hair. In addition, macrocephaly and coarse facial features, including a broad nasal bridge, epicanthal folds, a wide mouth, and full lips, can be suggestive of a storage disorder. About half of affected individuals are macrosomic and edematous at birth, whereas in childhood they usually have a muscular appearance with little subcutaneous fat. Thickened calvarium, narrow thorax, wide ribs, flattened or ovoid vertebral bodies, coxa valga, osteopenia, enlarged medullary canals, and metaphyseal widening of long bones have been reported. Cardiac manifestations such as patent ductus arteriosus, ventricular hypertrophy, pulmonary hypertension, and pericardial effusions are present in approximately 80% of cases. Motor development is usually delayed due to hypotonia. Most patients have a mild speech delay, and a small percentage have learning difficulties or intellectual disability.

Topology

Extracellular: 1-30 aa
Helical: 31-51 aa
Cytoplasmic: 52-72 aa
Helical: 73-93 aa
Extracellular: 94-101 aa
Helical: 102-122 aa
Cytoplasmic: 123-132 aa
Helical: 133-153 aa
Extracellular: 154-167 aa
Helical: 168-188 aa
Cytoplasmic: 189-301 aa
Helical: 302-322 aa
Extracellular: 323-350 aa
Helical: 351-371 aa
Cytoplasmic: 372-423 aa
Helical: 424-444 aa
Extracellular: 445-455 aa
Helical: 456-476 aa
Cytoplasmic: 477-531 aa
Helical: 532-552 aa
Extracellular: 553-571 aa
Helical: 572-592 aa
Cytoplasmic: 593-990 aa
Helical: 991-1011 aa
Extracellular: 1012-1034 aa
Helical: 1035-1055 aa
Cytoplasmic: 1056-1127 aa
Helical: 1128-1148 aa
Extracellular: 1149-1245 aa
Helical: 1246-1266 aa
Cytoplasmic: 1267-1549 aa

More Infomation

References

Ahn, S. I., & Kim, Y. (2021). Human Blood–Brain Barrier on a Chip: Featuring Unique Multicellular Cooperation in Pathophysiology. Trends in Biotechnology.

Tektemur, A., Etem Önalan, E., Kaya Tektemur, N., Güngör, İ. H., Türk, G., & Kuloğlu, T. (2020). Verapamil‐induced ion channel and miRNA expression changes in rat testis and/or spermatozoa may be associated with male infertility. Andrologia, 52(10), e13778.

Mao, X., He, Z., Zhou, F., Huang, Y., & Zhu, G. (2019). Prognostic significance and molecular mechanisms of adenosine triphosphate-binding cassette subfamily C members in gastric cancer. Medicine, 98(50).

Jang, H., Choi, Y., Yoo, I., Han, J., Kim, M., & Ka, H. (2017). Expression and regulation of prostaglandin transporters, ATP-binding cassette, subfamily C, member 1 and 9, and solute carrier organic anion transporter family, member 2A1 and 5A1 in the uterine endometrium during the estrous cycle and pregnancy in pigs. Asian-Australasian journal of animal sciences, 30(5), 643.

Q & As

Ask a question We look forward to hearing from you.

0 reviews or Q&As

Purchasing FAQs
Technical FAQs

Review & reward

Have you used Mouse Anti-ABCC9 Recombinant Antibody (V2-179047)?
Submit a review and get a Coupon or an Amazon gift card. 20% off Coupon

$30 eGift Card
Submit a review

Protocols

Please try the standard protocols which include: protocols, troubleshooting and guide.

Enzyme-linked Immunosorbent Assay (ELISA)
Flow Cytometry
Immunofluorescence (IF)
Immunohistochemistry (IHC)
Immunoprecipitation (IP)
Western Blot (WB)
Enzyme-Linked Immunospot (ELISpot)
Proteogenomics
Other Protocols

Associated Products

Isotype control

For research use only. Not intended for any clinical use.

Custom Antibody Labeling

We also offer labeled antibodies developed using our catalog antibody products and nonfluorescent conjugates (HRP, AP, Biotin, etc.) or fluorescent conjugates (Alexa Fluor, FITC, TRITC, Rhodamine, Texas Red, R-PE, APC, Qdot Probes, Pacific Dyes, etc.).

Learn more

Documents

Datasheet
SDS
Request for COA

Request bulk or custom quote Online Inquiry
Second antibody and isotype control

Contact us

Tel: (USA)
(UK)
Fax:

Global Locations

Email: