Sign in or Register   Sign in or Register
  |  

Mouse Anti-EPHB4 Antibody (5BA24) (CBMAB-1207CQ)

This product is a mouse antibody that recognizes EPHB4. The antibody 5BA24 can be used for immunoassay techniques such as: ELISA.
See all EPHB4 antibodies

Summary

Host Animal
Mouse
Specificity
Human
Clone
5BA24
Antibody Isotype
IgG2b
Application
ELISA

Basic Information

Immunogen
Recombinant Domain (SNAPPAVSDIRVTRSSPSSLSLAWAVPRAPSGAVLDYEVKYHEKGAEGPSSVRFLKTSENRAELRGLKRGASYLVQVRARSEAGYGPFGQEHHSQTQLD)
Specificity
Human
Antibody Isotype
IgG2b
Clonality
Monoclonal
Application Notes
The COA includes recommended starting dilutions, optimal dilutions should be determined by the end user.

Formulations & Storage [For reference only, actual COA shall prevail!]

Format
Supernatant
Purity
>95% as determined by analysis by SDS-PAGE
Storage
Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze/thaw cycles.

Target

Full Name
EPH Receptor B4
Introduction
Eph receptors are the largest family of receptor tyrosine kinases (RTKs) and are divided into two subclasses, EphA and EphB. Originally identified as mediators of axon guidance, Eph receptors are implicated in many processes, particularly cancer development and progression.
Entrez Gene ID
UniProt ID
Alternative Names
EPH Receptor B4; Tyrosine-Protein Kinase TYRO11; Hepatoma Transmembrane Kinase; EC 2.7.10.1; TYRO11; MYK1; HTK; Tyrosine-Protein Kinase Receptor HTK; Soluble EPHB4 Variant 1; Soluble EPHB4 Variant 2; Soluble EPHB4 Variant 3; Ephrin Receptor EphB4; EC 2.7.10; EphB4
Research Area
Receptor tyrosine kinase which binds promiscuously transmembrane ephrin-B family ligands residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Together with its cognate ligand/functional ligand EFNB2 it is involved in the regulation of cell adhesion and migration, and plays a central role in heart morphogenesis, angiogenesis and blood vessel remodeling and permeability. EPHB4-mediated forward signaling controls cellular repulsion and segregation from EFNB2-expressing cells.
Biological Process
Angiogenesis Source: UniProtKB
Axon guidance Source: GO_Central
Cell adhesion Source: UniProtKB
Cell migration involved in sprouting angiogenesis Source: UniProtKB
Ephrin receptor signaling pathway Source: UniProtKB
Heart morphogenesis Source: UniProtKB
Positive regulation of kinase activity Source: GO_Central
Protein autophosphorylation Source: UniProtKB
Transmembrane receptor protein tyrosine kinase signaling pathway Source: GO_Central
Cellular Location
Cell membrane
Involvement in disease
Lymphatic malformation 7 (LMPHM7):
A form of primary lymphedema, a disease characterized by swelling of body parts due to developmental anomalies and functional defects of the lymphatic system. Patients with lymphedema may suffer from recurrent local infections. LMPHM7 is an autosomal dominant form with variable expressivity. Some individuals present with severe non-immune hydrops fetalis, which may cause perinatal demise or fully resolve after the neonatal period. Others present with no edema and have milder clinical features, such as atrial septal defect or varicose veins as adults.
Capillary malformation-arteriovenous malformation 2 (CMAVM2):
An autosomal dominant disorder characterized by multiple, round to oval or more irregularly shaped macules that are pinkish red in color and are randomly distributed across the body. These capillary malformations are associated with either arteriovenous malformation, arteriovenous fistula, or Parkes Weber syndrome.
Topology
Extracellular: 16-539
Helical: 540-560
Cytoplasmic: 561-987
PTM
Phosphorylated; autophosphorylation is stimulated by EFNB2.
Ask a question We look forward to hearing from you.
0 reviews or Q&As
Loading...
Have you used Mouse Anti-EPHB4 Antibody (5BA24)?
Submit a review and get a Coupon or an Amazon gift card. 20% off Coupon $30 eGift Card
Submit a review
Loading...
For research use only. Not intended for any clinical use.

Custom Antibody Labeling

We also offer labeled antibodies developed using our catalog antibody products and nonfluorescent conjugates (HRP, AP, Biotin, etc.) or fluorescent conjugates (Alexa Fluor, FITC, TRITC, Rhodamine, Texas Red, R-PE, APC, Qdot Probes, Pacific Dyes, etc.).

Online Inquiry

Documents

Contact us

  • Tel: (USA)
  • (UK)
  • Fax:
  • Email:

Submit A Review

Go to
Compare