Sign in or Register   Sign in or Register
  |  

Mouse Anti-EWSR1 Recombinant Antibody (4B4) (CBMAB-BR174LY)

The product is antibody recognizes EWSR1. The antibody 4B4 immunoassay techniques such as: IHC, WB.
See all EWSR1 antibodies

Summary

Host Animal
Mouse
Specificity
Human, Monkey, Mouse
Clone
4B4
Antibody Isotype
IgG2b
Application
IHC: 1:300-1:500 dilution, WB: 0.1-0.5 μg/ml

Basic Information

Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human EWSR1 (369-399aa NDSVTLDDLADFFKQCGVVKMNKRTGQPMIH), different from the related mouse sequence by one amino acid
Specificity
Human, Monkey, Mouse
Antibody Isotype
IgG2b
Clonality
Monoclonal
Application Notes
The COA includes recommended starting dilutions, optimal dilutions should be determined by the end user.

Formulations & Storage [For reference only, actual COA shall prevail!]

Format
Lyophilized
Preservative
0.05 mg sodium azide
Storage
Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freezethaw cycles.

Target

Full Name
EWS RNA Binding Protein 1
Introduction
This gene encodes a multifunctional protein that is involved in various cellular processes, including gene expression, cell signaling, and RNA processing and transport. The protein includes an N-terminal transcriptional activation domain and a C-terminal RNA-binding domain. Chromosomal translocations between this gene and various genes encoding transcription factors result in the production of chimeric proteins that are involved in tumorigenesis. These chimeric proteins usually consist of the N-terminal transcriptional activation domain of this protein fused to the C-terminal DNA-binding domain of the transcription factor protein. Mutations in this gene, specifically a t(11;22)(q24;q12) translocation, are known to cause Ewing sarcoma as well as neuroectodermal and various other tumors. Alternative splicing of this gene results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 1 and 14. [provided by RefSeq, Jul 2009]
Entrez Gene ID
Human2130
Mouse14030
Monkey714432
UniProt ID
HumanQ01844
MouseQ61545
MonkeyA0A0D9RBS5
Alternative Names
RNA-binding protein EWS; EWS oncogene; Ewing sarcoma breakpoint region 1 protein; EWSR1; EWS
Research Area
Might normally function as a transcriptional repressor. EWS-fusion-proteins (EFPS) may play a role in the tumorigenic process. They may disturb gene expression by mimicking, or interfering with the normal function of CTD-POLII within the transcription initiation complex. They may also contribute to an aberrant activation of the fusion protein target genes.
Cellular Location
Nucleus; Cytoplasm; Cell membrane. Relocates from cytoplasm to ribosomes upon PTK2B/FAK2 activation.
Involvement in disease
Ewing sarcoma (ES):
The protein represented in this entry is involved in disease pathogenesis. Chromosomal aberrations involving EWSR1 are found in patients with Ewing sarcoma. Translocation t(11;22)(q24;q12) with FLI1 (PubMed:1522903, PubMed:15044653). Translocation t(7;22)(p22;q12) with ETV1 (PubMed:7700648). Translocation t(21;22)(q22;q21) with ERG (PubMed:15044653). Translocation t(2;21;22)(q23;q22;q12) that forms a EWSR1-FEV fusion protein with potential oncogenic activity (PubMed:9121764).A highly malignant, metastatic, primitive small round cell tumor of bone and soft tissue that affects children and adolescents. It belongs to the Ewing sarcoma family of tumors, a group of morphologically heterogeneous neoplasms that share the same cytogenetic features. They are considered neural tumors derived from cells of the neural crest. Ewing sarcoma represents the less differentiated form of the tumors.
A chromosomal aberration involving EWSR1 has been found in extraskeletal myxoid chondrosarcoma. Translocation t(9;22)(q22-31;q11-12) with NR4A3.
A chromosomal aberration involving EWSR1 is associated with desmoplastic small round cell tumor (DSRCT). Translocation t(11;22)(p13;q12) with WT1.
A chromosomal aberration involving EWSR1 is associated with malignant melanoma of soft parts (MMSP). Translocation t(12;22)(q13;q12) with ATF1. Malignant melanoma of soft parts, also known as soft tissue clear cell sarcoma, is a rare tumor developing in tendons and aponeuroses.
A chromosomal aberration involving EWSR1 is associated with small round cell sarcoma. Translocation t(11;22)(p36.1;q12) with PATZ1.
Angiomatoid fibrous histiocytoma (AFH):
The gene represented in this entry is involved in disease pathogenesis. Chromosomal aberrations involving EWSR1 are found in patients with angiomatoid fibrous histiocytoma. Translocation t(12;22)(q13;q12) with ATF1 generates a chimeric EWSR1/ATF1 protein (PubMed:15884099). Translocation t(2;22)(q33;q12) with CREB1 generates a EWSR1/CREB1 fusion gene that is most common genetic abnormality in this tumor type (PubMed:17724745). A distinct variant of malignant fibrous histiocytoma that typically occurs in children and adolescents and is manifest by nodular subcutaneous growth. Characteristic microscopic features include lobulated sheets of histiocyte-like cells intimately associated with areas of hemorrhage and cystic pseudovascular spaces, as well as a striking cuffing of inflammatory cells, mimicking a lymph node metastasis.
EFPS arise due to chromosomal translocations in which EWSR1 is fused to a variety of cellular transcription factors. EFPS are very potent transcriptional activators dependent on the EAD and a C-terminal DNA-binding domain contributed by the fusion partner. The spectrum of malignancies associated with EFPS are thought to arise via EFP-induced transcriptional deregulation, with the tumor phenotype specified by the EWSR1 fusion partner and cell type. Transcriptional repression of the transforming growth factor beta type II receptor (TGF beta RII) is an important target of the EWS-FLI1, EWS-ERG, or EWS-ETV1 oncogene.
PTM
Phosphorylated; calmodulin-binding inhibits phosphorylation of Ser-266.
Highly methylated on arginine residues. Methylation is mediated by PRMT1 and, at lower level by PRMT8.

Pan, Z., Zhao, R., Li, B., Qi, Y., Qiu, W., Guo, Q., ... & Li, G. (2022). EWSR1-induced circNEIL3 promotes glioma progression and exosome-mediated macrophage immunosuppressive polarization via stabilizing IGF2BP3. Molecular cancer, 21(1), 1-23.

Lucas, C. H. G., Gupta, R., Wu, J., Shah, K., Ravindranathan, A., Barreto, J., ... & Solomon, D. A. (2022). EWSR1-BEND2 fusion defines an epigenetically distinct subtype of astroblastoma. Acta neuropathologica, 143(1), 109-113.

García-Domínguez, D. J., Hajji, N., Sánchez-Molina, S., Figuerola-Bou, E., de Pablos, R. M., Espinosa-Oliva, A. M., ... & Hontecillas-Prieto, L. (2021). Selective inhibition of HDAC6 regulates expression of the oncogenic driver EWSR1-FLI1 through the EWSR1 promoter in Ewing sarcoma. Oncogene, 40(39), 5843-5853.

Lopez‐Nunez, O., Cafferata, B., Santi, M., Ranganathan, S., Pearce, T. M., Kulich, S. M., ... & Surrey, L. F. (2021). The spectrum of rare central nervous system (CNS) tumors with EWSR1‐non‐ETS fusions: experience from three pediatric institutions with review of the literature. Brain Pathology, 31(1), 70-83.

Flucke, U., van Noesel, M. M., Siozopoulou, V., Creytens, D., Tops, B. B., van Gorp, J. M., & Hiemcke-Jiwa, L. S. (2021). EWSR1—The Most Common Rearranged Gene in Soft Tissue Lesions, Which Also Occurs in Different Bone Lesions: An Updated Review. Diagnostics, 11(6), 1093.

Skálová, A., Agaimy, A., Vanecek, T., Baněčková, M., Laco, J., Ptáková, N., ... & Leivo, I. (2021). Molecular profiling of clear cell myoepithelial carcinoma of salivary glands with EWSR1 rearrangement identifies frequent PLAG1 gene fusions but no EWSR1 fusion transcripts. The American Journal of Surgical Pathology, 45(1), 1-13.

Hung, Y. P., Fisch, A. S., Diaz‐Perez, J. A., Iafrate, A. J., Lennerz, J. K., Nardi, V., ... & Nielsen, G. P. (2021). Identification of EWSR1–NFATC2 fusion in simple bone cysts. Histopathology, 78(6), 849-856.

Thway, K., & Fisher, C. (2019). Mesenchymal tumors with EWSR1 gene rearrangements. Surgical Pathology Clinics, 12(1), 165-190.

Bridge, J. A., Sumegi, J., Druta, M., Bui, M. M., Henderson-Jackson, E., Linos, K., ... & Brohl, A. S. (2019). Clinical, pathological, and genomic features of EWSR1-PATZ1 fusion sarcoma. Modern Pathology, 32(11), 1593-1604.

Yoshida, A., Wakai, S., Ryo, E., Miyata, K., Miyazawa, M., Yoshida, K. I., ... & Mori, T. (2019). Expanding the phenotypic spectrum of mesenchymal tumors harboring the EWSR1-CREM fusion. The American Journal of Surgical Pathology, 43(12), 1622-1630.

Ask a question We look forward to hearing from you.
0 reviews or Q&As
Loading...
Have you used Mouse Anti-EWSR1 Recombinant Antibody (4B4)?
Submit a review and get a Coupon or an Amazon gift card. 20% off Coupon $30 eGift Card
Submit a review
Loading...
For research use only. Not intended for any clinical use.

Custom Antibody Labeling

We also offer labeled antibodies developed using our catalog antibody products and nonfluorescent conjugates (HRP, AP, Biotin, etc.) or fluorescent conjugates (Alexa Fluor, FITC, TRITC, Rhodamine, Texas Red, R-PE, APC, Qdot Probes, Pacific Dyes, etc.).

Online Inquiry

Documents

Contact us

  • Tel: (USA)
  • (UK)
  • Fax:
  • Email:

Submit A Review

Go to
Compare