Sign in or Register   Sign in or Register
  |  

Mouse Anti-PPT1 Recombinant Antibody (10F3) (CBMAB-BR399LY)

The product is antibody recognizes PPT1. The antibody 10F3 immunoassay techniques such as: FC, IHC-P, WB.
See all PPT1 antibodies

Summary

Host Animal
Mouse
Specificity
Human
Clone
10F3
Antibody Isotype
IgG2b
Application
FC: 1-3 μg/1x10 cells, IHC-P: 0.5-1 μg/ml, WB: 0.1-0.5 μg/ml

Basic Information

Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human PPT1 (191-224aa KEDVYRNHSIFLADINQERGINESYKKNLMALKK), different from the related mouse and rat sequences by four amino acids.
Specificity
Human
Antibody Isotype
IgG2b
Application Notes
The COA includes recommended starting dilutions, optimal dilutions should be determined by the end user.

Formulations & Storage [For reference only, actual COA shall prevail!]

Format
Lyophilized
Preservative
0.05 mg sodium azide
Storage
Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freezethaw cycles.

Target

Full Name
palmitoyl-protein thioesterase 1
Entrez Gene ID
UniProt ID
Alternative Names
Palmitoyl-protein thioesterase 1; PPT-1; Palmitoyl-protein hydrolase 1; PPT1; CLN1; PPT
Function
Removes thioester-linked fatty acyl groups such as palmitate from modified cysteine residues in proteins or peptides during lysosomal degradation. Prefers acyl chain lengths of 14 to 18 carbons (PubMed:8816748).
Biological Process
Adult locomotory behaviorIEA:Ensembl
Associative learningIEA:Ensembl
Brain developmentManual Assertion Based On ExperimentIMP:UniProtKB
Cellular macromolecule catabolic processIEA:Ensembl
Fatty-acyl-CoA biosynthetic processTAS:Reactome
Grooming behaviorIEA:Ensembl
Lipid catabolic processManual Assertion Based On ExperimentIDA:UniProtKB
Lysosomal lumen acidificationManual Assertion Based On ExperimentIMP:UniProtKB
Membrane raft organizationManual Assertion Based On ExperimentIMP:UniProtKB
Negative regulation of apoptotic processManual Assertion Based On ExperimentIDA:UniProtKB
Negative regulation of cell growthManual Assertion Based On ExperimentIMP:UniProtKB
Negative regulation of neuron apoptotic processManual Assertion Based On ExperimentIMP:UniProtKB
Nervous system developmentManual Assertion Based On ExperimentIMP:UniProtKB
Neuron developmentManual Assertion Based On ExperimentTAS:UniProtKB
Neurotransmitter secretionIEA:Ensembl
PinocytosisManual Assertion Based On ExperimentIMP:MGI
Positive regulation of pinocytosisManual Assertion Based On ExperimentIMP:UniProtKB
Positive regulation of receptor-mediated endocytosisManual Assertion Based On ExperimentIMP:UniProtKB
Protein catabolic process1 PublicationNAS:UniProtKB
Protein depalmitoylationManual Assertion Based On ExperimentIDA:UniProtKB
Protein transportManual Assertion Based On ExperimentIMP:UniProtKB
Receptor-mediated endocytosisManual Assertion Based On ExperimentIMP:MGI
Regulation of phospholipase A2 activityIEA:Ensembl
Regulation of synapse structure or activity1 PublicationNAS:UniProtKB
Response to stimulusIEA:UniProtKB-KW
Sphingolipid catabolic processManual Assertion Based On ExperimentTAS:UniProtKB
Visual perceptionIEA:UniProtKB-KW
Cellular Location
Lysosome
Secreted
Involvement in disease
Ceroid lipofuscinosis, neuronal, 1 (CLN1):
A form of neuronal ceroid lipofuscinosis with variable age at onset. Infantile, late-infantile, juvenile, and adult onset have been reported. Neuronal ceroid lipofuscinoses are progressive neurodegenerative, lysosomal storage diseases characterized by intracellular accumulation of autofluorescent liposomal material, and clinically by seizures, dementia, visual loss, and/or cerebral atrophy. The lipopigment pattern seen most often in CLN1 is referred to as granular osmiophilic deposits (GROD).
PTM
Glycosylated.
Ask a question We look forward to hearing from you.
0 reviews or Q&As
Loading...
Have you used Mouse Anti-PPT1 Recombinant Antibody (10F3)?
Submit a review and get a Coupon or an Amazon gift card. 20% off Coupon $30 eGift Card
Submit a review
Loading...
For research use only. Not intended for any clinical use.

Custom Antibody Labeling

We also offer labeled antibodies developed using our catalog antibody products and nonfluorescent conjugates (HRP, AP, Biotin, etc.) or fluorescent conjugates (Alexa Fluor, FITC, TRITC, Rhodamine, Texas Red, R-PE, APC, Qdot Probes, Pacific Dyes, etc.).

Online Inquiry

Documents

Contact us

  • Tel: (USA)
  • (UK)
  • Fax:
  • Email:

Submit A Review

Go to
Compare