Mouse Anti-MOG Recombinant Antibody (CBFYM-2467) (CBMAB-M2654-FY)

Go to compare Compare Online Inquiry
Request for COA
Datasheet Target References Q & As Review & reward Protocols Associated Products

Basic Information

Host Animal
Mouse
Clone
CBFYM-2467
Application
WB, IHC, IHC-P
Immunogen
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence ALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPG
Specificity
Human, Mouse, Rat
Antibody Isotype
IgG1
Clonality
Monoclonal
Application Notes
The COA includes recommended starting dilutions, optimal dilutions should be determined by the end user.

Formulations & Storage [For reference only, actual COA shall prevail!]

Format
Liquid
Storage
Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze/thaw cycles.
More Infomation

Target

Full Name
Myelin Oligodendrocyte Glycoprotein
Introduction
The product of this gene is a membrane protein expressed on the oligodendrocyte cell surface and the outermost surface of myelin sheaths. Due to this localization, it is a primary target antigen involved in immune-mediated demyelination. This protein may be involved in completion and maintenance of the myelin sheath and in cell-cell communication. Alternatively spliced transcript variants encoding different isoforms have been identified.
Entrez Gene ID
Human4340
Mouse17441
Rat24558
UniProt ID
HumanQ16653
MouseQ61885
RatQ63345
Alternative Names
Myelin Oligodendrocyte Glycoprotein; Myelin-Oligodendrocyte Glycoprotein; MOG Ig-AluB; MOG Alpha-5; MOG AluA; MOG AluB
Function
Mediates homophilic cell-cell adhesion (By similarity).

Minor component of the myelin sheath. May be involved in completion and/or maintenance of the myelin sheath and in cell-cell communication.

(Microbial infection) Acts as a receptor for rubella virus.
Biological Process
Cell adhesion Source: UniProtKB-KW
Central nervous system development Source: ProtInc
Regulation of cytokine production Source: GO_Central
T cell receptor signaling pathway Source: GO_Central
Cellular Location
Cell membrane
Involvement in disease
Narcolepsy 7 (NRCLP7):
Neurological disabling sleep disorder, characterized by excessive daytime sleepiness, sleep fragmentation, symptoms of abnormal rapid-eye-movement (REM) sleep, cataplexy, hypnagogic hallucinations, and sleep paralysis. Cataplexy is a sudden loss of muscle tone triggered by emotions, which is the most valuable clinical feature used to diagnose narcolepsy. Human narcolepsy is primarily a sporadically occurring disorder but familial clustering has been observed.
Topology
Extracellular: 30-154
Helical: 155-175
Cytoplasmic: 176-210
Helical: 211-231
Extracellular: 232-247

Carta, S., Cobo Calvo, Á., Armangué, T., Saiz, A., Lechner, C., Rostásy, K., ... & Mariotto, S. (2023). Significance of myelin oligodendrocyte glycoprotein antibodies in CSF: a retrospective multicenter study. Neurology, 100(11), e1095-e1108.

Corbali, O., & Chitnis, T. (2023). Pathophysiology of myelin oligodendrocyte glycoprotein antibody disease. Frontiers in Neurology, 14, 1137998.

Kwon, Y. N., Kim, B., Kim, J. S., Mo, H., Choi, K., Oh, S. I., ... & Kim, S. M. (2021). Myelin oligodendrocyte glycoprotein-immunoglobulin G in the CSF: clinical implication of testing and association with disability. Neurology: Neuroimmunology & Neuroinflammation, 9(1), e1095.

Marignier, R., Hacohen, Y., Cobo-Calvo, A., Pröbstel, A. K., Aktas, O., Alexopoulos, H., ... & Hemmer, B. (2021). Myelin-oligodendrocyte glycoprotein antibody-associated disease. The Lancet Neurology, 20(9), 762-772.

Sechi, E., Buciuc, M., Pittock, S. J., Chen, J. J., Fryer, J. P., Jenkins, S. M., ... & Flanagan, E. P. (2021). Positive predictive value of myelin oligodendrocyte glycoprotein autoantibody testing. JAMA neurology, 78(6), 741-746.

Foiadelli, T., Gastaldi, M., Scaranzin, S., Franciotta, D., & Savasta, S. (2020). Seizures and myelin oligodendrocyte glycoprotein (MOG) antibodies: two paradigmatic cases and a review of the literature. Multiple Sclerosis and Related Disorders, 41, 102011.

Takai, Y., Misu, T., Kaneko, K., Chihara, N., Narikawa, K., Tsuchida, S., ... & Japan MOG-antibody Disease Consortium Otsuka Yoshihisa Nishimaki Keiichi Ishigaki Sho Yoshida Kazunari Iguchi Yasuyuki Fukuda Takahiro Nohara Seitaro Tamaoka Akira Fujimori Juichi. (2020). Myelin oligodendrocyte glycoprotein antibody-associated disease: an immunopathological study. Brain, 143(5), 1431-1446.

Ambrosius, W., Michalak, S., Kozubski, W., & Kalinowska, A. (2020). Myelin oligodendrocyte glycoprotein antibody-associated disease: current insights into the disease pathophysiology, diagnosis and management. International journal of molecular sciences, 22(1), 100.

Reindl, M., & Waters, P. (2019). Myelin oligodendrocyte glycoprotein antibodies in neurological disease. Nature Reviews Neurology, 15(2), 89-102.

Tea, F., Lopez, J. A., Ramanathan, S., Merheb, V., Lee, F. X., Zou, A., ... & Brilot, F. (2019). Characterization of the human myelin oligodendrocyte glycoprotein antibody response in demyelination. Acta Neuropathologica Communications, 7, 1-22.

Ask a question We look forward to hearing from you.
0 reviews or Q&As
Loading...
Have you used Mouse Anti-MOG Recombinant Antibody (CBFYM-2467)?
Submit a review and get a Coupon or an Amazon gift card. 20% off Coupon $30 eGift Card
Submit a review
Loading...
For research use only. Not intended for any clinical use.

Custom Antibody Labeling

We also offer labeled antibodies developed using our catalog antibody products and nonfluorescent conjugates (HRP, AP, Biotin, etc.) or fluorescent conjugates (Alexa Fluor, FITC, TRITC, Rhodamine, Texas Red, R-PE, APC, Qdot Probes, Pacific Dyes, etc.).

Online Inquiry

Contact us

  • Tel: (USA)
  • (UK)
  • Fax:
  • Email:

Submit A Review

online inquiry
Online Inquiry