Mouse Anti-HSPA1A Recombinant Antibody (3H5) (CBMAB-BR263LY)

Go to compare Compare Online Inquiry
Request for COA
Datasheet Target References Q & As Review & reward Protocols Associated Products

Basic Information

Host Animal
Mouse
Clone
3H5
Application
FC: 1-3 μg/1x10 cells
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human Hsp70 (559-596aa KGKISEADKKKVLDKCQEVISWLDANTLAEKDEFEHKR), different from the related mouse sequence by five amino acids, and from the related rat sequence by three amino acids.
Specificity
Human
Antibody Isotype
IgG1
Clonality
Monoclonal
Application Notes
The COA includes recommended starting dilutions, optimal dilutions should be determined by the end user.

Formulations & Storage [For reference only, actual COA shall prevail!]

Format
Liquid
Buffer
50% glycerol
Preservative
0.02% sodium azide
Storage
Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freezethaw cycles.
More Infomation

Target

Full Name
Heat Shock Protein Family A (Hsp70) Member 1A
Introduction
This intronless gene encodes a 70kDa heat shock protein which is a member of the heat shock protein 70 family. In conjuction with other heat shock proteins, this protein stabilizes existing proteins against aggregation and mediates the folding of newly translated proteins in the cytosol and in organelles. It is also involved in the ubiquitin-proteasome pathway through interaction with the AU-rich element RNA-binding protein 1. The gene is located in the major histocompatibility complex class III region, in a cluster with two closely related genes which encode similar proteins. [provided by RefSeq, Jul 2008]
Entrez Gene ID
UniProt ID
Alternative Names
Heat shock 70 kDa protein 1A; Heat shock 70 kDa protein 1B
Function
Molecular chaperone implicated in a wide variety of cellular processes, including protection of the proteome from stress, folding and transport of newly synthesized polypeptides, activation of proteolysis of misfolded proteins and the formation and dissociation of protein complexes. Plays a pivotal role in the protein quality control system, ensuring the correct folding of proteins, the re-folding of misfolded proteins and controlling the targeting of proteins for subsequent degradation. This is achieved through cycles of ATP binding, ATP hydrolysis and ADP release, mediated by co-chaperones. The co-chaperones have been shown to not only regulate different steps of the ATPase cycle, but they also have an individual specificity such that one co-chaperone may promote folding of a substrate while another may promote degradation. The affinity for polypeptides is regulated by its nucleotide bound state. In the ATP-bound form, it has a low affinity for substrate proteins. However, upon hydrolysis of the ATP to ADP, it undergoes a conformational change that increases its affinity for substrate proteins. It goes through repeated cycles of ATP hydrolysis and nucleotide exchange, which permits cycles of substrate binding and release. The co-chaperones are of three types: J-domain co-chaperones such as HSP40s (stimulate ATPase hydrolysis by HSP70), the nucleotide exchange factors (NEF) such as BAG1/2/3 (facilitate conversion of HSP70 from the ADP-bound to the ATP-bound state thereby promoting substrate release), and the TPR domain chaperones such as HOPX and STUB1 (PubMed:24012426, PubMed:26865365, PubMed:24318877).

Maintains protein homeostasis during cellular stress through two opposing mechanisms: protein refolding and degradation. Its acetylation/deacetylation state determines whether it functions in protein refolding or protein degradation by controlling the competitive binding of co-chaperones HOPX and STUB1. During the early stress response, the acetylated form binds to HOPX which assists in chaperone-mediated protein refolding, thereafter, it is deacetylated and binds to ubiquitin ligase STUB1 that promotes ubiquitin-mediated protein degradation (PubMed:27708256).

Regulates centrosome integrity during mitosis, and is required for the maintenance of a functional mitotic centrosome that supports the assembly of a bipolar mitotic spindle (PubMed:27137183).

Enhances STUB1-mediated SMAD3 ubiquitination and degradation and facilitates STUB1-mediated inhibition of TGF-beta signaling (PubMed:24613385).

Essential for STUB1-mediated ubiquitination and degradation of FOXP3 in regulatory T-cells (Treg) during inflammation (PubMed:23973223).

Negatively regulates heat shock-induced HSF1 transcriptional activity during the attenuation and recovery phase period of the heat shock response (PubMed:9499401).

Involved in the clearance of misfolded PRDM1/Blimp-1 proteins. Sequesters them in the cytoplasm and promotes their association with SYNV1/HRD1, leading to proteasomal degradation (PubMed:28842558).
(Microbial infection) In case of rotavirus A infection, serves as a post-attachment receptor for the virus to facilitate entry into the cell.
Biological Process
ATP metabolic process Source: BHF-UCL
Cellular heat acclimation Source: UniProtKB
Cellular response to heat Source: UniProtKB
Cellular response to oxidative stress Source: ParkinsonsUK-UCL
Cellular response to steroid hormone stimulus Source: Reactome
Cellular response to unfolded protein Source: ParkinsonsUK-UCL
Chaperone cofactor-dependent protein refolding Source: GO_Central
Chaperone-mediated protein complex assembly Source: CAFA
Lysosomal transport Source: UniProtKB
mRNA catabolic process Source: UniProtKB
Negative regulation of apoptotic process Source: UniProtKB
Negative regulation of cell death Source: UniProtKB
Negative regulation of cell growth Source: UniProtKB
Negative regulation of cell population proliferation Source: UniProtKB
Negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway Source: ParkinsonsUK-UCL
Negative regulation of extrinsic apoptotic signaling pathway in absence of ligand Source: BHF-UCL
Negative regulation of inclusion body assembly Source: UniProtKB
Negative regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway Source: ParkinsonsUK-UCL
Negative regulation of protein ubiquitination Source: ParkinsonsUK-UCL
Negative regulation of transcription from RNA polymerase II promoter in response to stress Source: UniProtKB
Negative regulation of transforming growth factor beta receptor signaling pathway Source: UniProtKB
Positive regulation of endoribonuclease activity Source: ParkinsonsUK-UCL
Positive regulation of erythrocyte differentiation Source: UniProtKB
Positive regulation of gene expression Source: BHF-UCL
Positive regulation of interleukin-8 production Source: UniProtKB
Positive regulation of microtubule nucleation Source: UniProtKB
Positive regulation of NF-kappaB transcription factor activity Source: UniProtKB
Positive regulation of nucleotide-binding oligomerization domain containing 2 signaling pathway Source: UniProtKB
Positive regulation of proteasomal ubiquitin-dependent protein catabolic process Source: UniProtKB
Positive regulation of RNA splicing Source: ParkinsonsUK-UCL
Positive regulation of tumor necrosis factor-mediated signaling pathway Source: UniProtKB
Protein refolding Source: UniProtKB
Protein stabilization Source: CAFA
Regulation of mitotic spindle assembly Source: UniProtKB
Regulation of protein ubiquitination Source: BHF-UCL
Response to unfolded protein Source: UniProtKB
Vesicle-mediated transport Source: GO_Central
Cellular Location
Nucleus; Centrosome; Cytoplasm; Secreted. Localized in cytoplasmic mRNP granules containing untranslated mRNAs.
Involvement in disease
In certain aggressive cases of activated B cell-like diffuse large B-cell lymphoma (ABC-DLBCL), plays a role in the cytoplasmic sequestration of misfolded N-terminal mutated PRDM1 proteins, promotes their association with SYNV1/HRD1 and degradation through the SYNV1-proteasome pathway. HSPA1A inhibition restores PRDM1 nuclear localization and transcriptional activity in lymphoma cell lines and suppresses growth in xenografts.
PTM
In response to cellular stress, acetylated at Lys-77 by NA110 and then gradually deacetylated by HDAC4 at later stages. Acetylation enhances its chaperone activity and also determines whether it will function as a chaperone for protein refolding or degradation by controlling its binding to co-chaperones HOPX and STUB1. The acetylated form and the non-acetylated form bind to HOPX and STUB1 respectively. Acetylation also protects cells against various types of cellular stress.

de Freitas, G. B., Penteado, L., Miranda, M. M., Filassi, J. R., Baracat, E. C., & Linhares, I. M. (2022). The circulating 70 kDa heat shock protein (HSPA1A) level is a potential biomarker for breast carcinoma and its progression. Scientific Reports, 12(1), 13012.

Dong, Y., Li, T., Ma, Z., Zhou, C., Wang, X., & Li, J. (2022). HSPA1A, HSPA2, and HSPA8 are potential molecular biomarkers for prognosis among HSP70 family in alzheimer’s disease. Disease Markers, 2022.

Wu, S., Pei, Q., Ni, W., Fu, X., Zhang, W., Song, C., ... & Yao, M. (2021). HSPA1A Protects Cells from Thermal Stress by Impeding ESCRT-0–Mediated Autophagic Flux in Epidermal Thermoresistance. Journal of Investigative Dermatology, 141(1), 48-58.

Guan, Y., Zhu, X., Liang, J., Wei, M., Huang, S., & Pan, X. (2021). Upregulation of HSPA1A/HSPA1B/HSPA7 and downregulation of HSPA9 were related to poor survival in colon cancer. Frontiers in oncology, 11, 749673.

Ban, Y., Tan, P., Cai, J., Li, J., Hu, M., Zhou, Y., ... & Xiang, B. (2020). LNCAROD is stabilized by m6A methylation and promotes cancer progression via forming a ternary complex with HSPA1A and YBX1 in head and neck squamous cell carcinoma. Molecular oncology, 14(6), 1282-1296.

Zhang, S., Wang, B., Xiao, H., Dong, J., Li, Y., Zhu, C., ... & Fan, S. (2020). LncRNA HOTAIR enhances breast cancer radioresistance through facilitating HSPA1A expression via sequestering miR‐449b‐5p. Thoracic cancer, 11(7), 1801-1816.

Chen, Q., Wu, K., Qin, X., Yu, Y., Wang, X., & Wei, K. (2020). LASP1 promotes proliferation, metastasis, invasion in head and neck squamous cell carcinoma and through direct interaction with HSPA1A. Journal of cellular and molecular medicine, 24(2), 1626-1639.

Bilog, A. D., Smulders, L., Oliverio, R., Labanieh, C., Zapanta, J., Stahelin, R. V., & Nikolaidis, N. (2019). Membrane localization of HspA1A, a stress inducible 70-kDa heat-shock protein, depends on its interaction with intracellular phosphatidylserine. Biomolecules, 9(4), 152.

Deane, C. A., & Brown, I. R. (2018). Knockdown of heat shock proteins HSPA6 (Hsp70B’) and HSPA1A (Hsp70-1) sensitizes differentiated human neuronal cells to cellular stress. Neurochemical Research, 43, 340-350.

Saquib, Q., Siddiqui, M. A., Ahmad, J., Ansari, S. M., Al-Wathnani, H. A., & Rensing, C. (2018). 6-OHBDE-47 induces transcriptomic alterations of CYP1A1, XRCC2, HSPA1A, EGR1 genes and trigger apoptosis in HepG2 cells. Toxicology, 400, 40-47.

Ask a question We look forward to hearing from you.
0 reviews or Q&As
Loading...
Have you used Mouse Anti-HSPA1A Recombinant Antibody (3H5)?
Submit a review and get a Coupon or an Amazon gift card. 20% off Coupon $30 eGift Card
Submit a review
Loading...
For research use only. Not intended for any clinical use.

Custom Antibody Labeling

We also offer labeled antibodies developed using our catalog antibody products and nonfluorescent conjugates (HRP, AP, Biotin, etc.) or fluorescent conjugates (Alexa Fluor, FITC, TRITC, Rhodamine, Texas Red, R-PE, APC, Qdot Probes, Pacific Dyes, etc.).

Online Inquiry

Contact us

  • Tel: (USA)
  • (UK)
  • Fax:
  • Email:

Submit A Review

online inquiry
Online Inquiry

This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.