Mouse Anti-LAMB1 Recombinant Antibody (CBYJL-1102) (CBMAB-L0564-YJ)

Go to compare Compare Online Inquiry
Request for COA
Datasheet Target References Q & As Review & reward Protocols Associated Products

Basic Information

Host Animal
Mouse
Clone
CBYJL-1102
Application
WB, IHC-P
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GPRCDKCTRGYSGVFPDCTPCHQCFALWDVIIAELTNRTHRFLEKAKALKISGVIGPYRETVDSVERKVSEIKDILAQSPAAEPLKNIGNLFEEAEKLIKDVTEMMAQVEVKLSDTTSQSNSTAKELDSLQTEAESLDNTVKELAEQLEF.
Specificity
Human
Antibody Isotype
IgG1
Clonality
Monoclonal
Application Notes
The COA includes recommended starting dilutions, optimal dilutions should be determined by the end user.

Formulations & Storage [For reference only, actual COA shall prevail!]

Buffer
PBS, pH 7.4
Storage
Store at 4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze/thaw cycles.
More Infomation

Target

Full Name
LAMB1
Introduction
Laminins, a family of extracellular matrix glycoproteins, are the major noncollagenous constituent of basement membranes. They have been implicated in a wide variety of biological processes including cell adhesion, differentiation, migration, signaling, neurite outgrowth and metastasis. Laminins are composed of 3 non identical chains: laminin alpha, beta and gamma (formerly A, B1, and B2, respectively) and they form a cruciform structure consisting of 3 short arms, each formed by a different chain, and a long arm composed of all 3 chains. Each laminin chain is a multidomain protein encoded by a distinct gene. Several isoforms of each chain have been described. Different alpha, beta and gamma chain isomers combine to give rise to different heterotrimeric laminin isoforms which are designated by Arabic numerals in the order of their discovery, i.e. alpha1beta1gamma1 heterotrimer is laminin 1. The biological functions of the different chains and trimer molecules are largely unknown, but some of the chains have been shown to differ with respect to their tissue distribution, presumably reflecting diverse functions in vivo. LAMB1 is the beta chain isoform laminin, beta 1. The beta 1 chain has 7 structurally distinct domains which it shares with other beta chain isomers. The C-terminal helical region containing domains I and II are separated by domain alpha, domains III and V contain several EGF-like repeats, and domains IV and VI have a globular conformation. Laminin, beta 1 is expressed in most tissues that produce basement membranes, and is one of the 3 chains constituting laminin 1, the first laminin isolated from Engelbreth-Holm-Swarm (EHS) tumor. A sequence in the beta 1 chain that is involved in cell attachment, chemotaxis, and binding to the laminin receptor was identified and shown to have the capacity to inhibit metastasis. Among its related pathways are ERK Signaling and Focal Adhesion.
Entrez Gene ID
UniProt ID
Alternative Names
CLM; LIS5
Function
Binding to cells via a high affinity receptor, laminin is thought to mediate the attachment, migration and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components. Involved in the organization of the laminar architecture of cerebral cortex. It is probably required for the integrity of the basement membrane/glia limitans that serves as an anchor point for the endfeet of radial glial cells and as a physical barrier to migrating neurons. Radial glial cells play a central role in cerebral cortical development, where they act both as the proliferative unit of the cerebral cortex and a scaffold for neurons migrating toward the pial surface.
Biological Process
Animal organ morphogenesisManual Assertion Based On ExperimentIBA:GO_Central
Basement membrane assemblyManual Assertion Based On ExperimentIBA:GO_Central
Cell adhesionManual Assertion Based On ExperimentTAS:HGNC-UCL
Cell migrationManual Assertion Based On ExperimentIBA:GO_Central
Endodermal cell differentiationManual Assertion Based On ExperimentIEP:UniProtKB
Neuron projection developmentManual Assertion Based On ExperimentIDA:UniProtKB
Neuronal-glial interaction involved in cerebral cortex radial glia guided migrationManual Assertion Based On ExperimentIMP:UniProtKB
OdontogenesisManual Assertion Based On ExperimentIDA:UniProtKB
Positive regulation of cell migrationManual Assertion Based On ExperimentIDA:UniProtKB
Positive regulation of epithelial cell proliferationManual Assertion Based On ExperimentTAS:HGNC-UCL
Substrate adhesion-dependent cell spreadingManual Assertion Based On ExperimentIDA:BHF-UCL
Tissue developmentManual Assertion Based On ExperimentIBA:GO_Central
Cellular Location
Secreted, extracellular space, extracellular matrix, basement membrane
Major component.
Involvement in disease
Lissencephaly 5 (LIS5):
An autosomal recessive brain malformation characterized by cobblestone changes in the cortex, more severe in the posterior region, and subcortical band heterotopia. Affected individuals have hydrocephalus, seizures, and severely delayed psychomotor development.

Toutouna, L., Beck‐Woedl, S., Feige, U., Glaeser, B., Komlosi, K., Eckenweiler, M., ... & Tzschach, A. (2023). Novel homozygous LAMB1 in‐frame deletion in a pediatric patient with brain anomalies and cerebrovascular event. American Journal of Medical Genetics Part A, 191(10), 2656-2663.

Morel, H., Bailly, L., Urbanczyk, C., Hervé, D., Berroir, S., Le Bouc, R., ... & Mathey, G. (2023). Extension of the Clinicoradiologic Spectrum of Newly Described End-Truncating LAMB1 Variations. Neurology: Genetics, 9(3).

Liu, T., Gan, H., He, S., Deng, J., Hu, X., Li, L., ... & Shan, H. (2022). RNA helicase DDX24 stabilizes LAMB1 to promote hepatocellular carcinoma progression. Cancer research, 82(17), 3074-3087.

Bai, M., Chen, H., Zhang, Z., Liu, X., Zhang, D., & Wang, C. (2022). Substrate stiffness promotes dentinogenesis via LAMB1–FAK–MEK1/2 signaling axis. Oral Diseases.

Luo, R., Wang, T., Zhuo, S., Guo, X., & Ma, D. (2022). Excessive hydrogen sulfide causes lung and brain tissue damage by promoting PARP1/Bax and C9 and inhibiting LAMB1. Apoptosis, 27(1-2), 149-160.

Lee, H., Kim, W. J., Kang, H. G., Jang, J. H., Choi, I. J., Chun, K. H., & Kim, S. J. (2021). Upregulation of LAMB1 via ERK/c-Jun axis promotes gastric cancer growth and motility. International journal of molecular sciences, 22(2), 626.

Ran, T., Chen, Z., Zhao, L., Ran, W., Fan, J., Hong, S., & Yang, Z. (2021). LAMB1 is related to the T stage and indicates poor prognosis in gastric cancer. Technology in cancer research & treatment, 20, 15330338211004944.

Aloui, C., Hervé, D., Marenne, G., Savenier, F., Le Guennec, K., Bergametti, F., ... & Tournier‐Lasserve, E. (2021). End‐truncated LAMB1 causes a hippocampal memory defect and a leukoencephalopathy. Annals of Neurology, 90(6), 962-975.

Sen, K., Kaur, S., Stockton, D. W., Nyhuis, M., & Roberson, J. (2021). Biallelic variants in LAMB1 causing Hydranencephaly: a severe phenotype of a rare Malformative encephalopathy. American Journal of Perinatology Reports, 11(01), e26-e28.

Yasuda, R., Yoshida, T., Mizuta, I., Watanabe, M., Nakano, M., Sato, R., ... & Mizuno, T. (2020). Adult-onset leukoencephalopathy with homozygous LAMB1 missense mutation. Neurology: Genetics, 6(4).

Ask a question We look forward to hearing from you.
0 reviews or Q&As
Loading...
Have you used Mouse Anti-LAMB1 Recombinant Antibody (CBYJL-1102)?
Submit a review and get a Coupon or an Amazon gift card. 20% off Coupon $30 eGift Card
Submit a review
Loading...
For research use only. Not intended for any clinical use.

Custom Antibody Labeling

We also offer labeled antibodies developed using our catalog antibody products and nonfluorescent conjugates (HRP, AP, Biotin, etc.) or fluorescent conjugates (Alexa Fluor, FITC, TRITC, Rhodamine, Texas Red, R-PE, APC, Qdot Probes, Pacific Dyes, etc.).

Online Inquiry

Contact us

  • Tel: (USA)
  • (UK)
  • Fax:
  • Email:

Submit A Review

online inquiry
Online Inquiry

This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.