Mouse Anti-METTL14 Recombinant Antibody (CBFYM-2122) (CBMAB-M2304-FY)

Go to compare Compare Online Inquiry
Request for COA
Datasheet Target References Q & As Review & reward Protocols Associated Products

Basic Information

Host Animal
Mouse
Clone
CBFYM-2122
Application
WB, IF, IHC-P
Immunogen
Recombinant protein corresponding to the following amino acid sequence:RSWNMDSRLQEIRERQKLRRQLLAQQLGAESADSIGAVLNSKDEQREIAETRETCRASYDTSAPNAKRKYLDEGETDEDKMEEYKDELEMQQDEE
Specificity
Human
Antibody Isotype
IgG2a
Application Notes
The COA includes recommended starting dilutions, optimal dilutions should be determined by the end user.

Formulations & Storage [For reference only, actual COA shall prevail!]

Format
Liquid
Storage
Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze/thaw cycles.
More Infomation

Target

Full Name
Methyltransferase Like 14
Introduction
METTL14 is a Protein Coding gene. Among its related pathways are Gene Expression and mRNA Splicing - Major Pathway. Gene Ontology annotations related to this gene include RNA binding and mRNA -methyltransferase activity.
Entrez Gene ID
UniProt ID
Alternative Names
Methyltransferase Like 14; Methyltransferase-Like Protein 14; HMETTL14; N6-Adenosine-Methyltransferase Non-Catalytic Subunit; N6-Adenosine-Methyltransferase Subunit METTL14; KIAA1627
Function
The METTL3-METTL14 heterodimer forms a N6-methyltransferase complex that methylates adenosine residues at the N6 position of some mRNAs and regulates the circadian clock, differentiation of embryonic stem cells and cortical neurogenesis (PubMed:24316715, PubMed:24407421, PubMed:25719671, PubMed:29348140, PubMed:27373337, PubMed:27281194).

In the heterodimer formed with METTL3, METTL14 constitutes the RNA-binding scaffold that recognizes the substrate rather than the catalytic core (PubMed:27627798, PubMed:27373337, PubMed:27281194, PubMed:29348140).

N6-methyladenosine (m6A), which takes place at the 5'-[AG]GAC-3' consensus sites of some mRNAs, plays a role in mRNA stability and processing (PubMed:24316715, PubMed:24407421, PubMed:25719671).

M6A acts as a key regulator of mRNA stability by promoting mRNA destabilization and degradation (By similarity).

In embryonic stem cells (ESCs), m6A methylation of mRNAs encoding key naive pluripotency-promoting transcripts results in transcript destabilization (By similarity).

M6A regulates spermatogonial differentiation and meiosis and is essential for male fertility and spermatogenesis (By similarity).

M6A also regulates cortical neurogenesis: m6A methylation of transcripts related to transcription factors, neural stem cells, the cell cycle and neuronal differentiation during brain development promotes their destabilization and decay, promoting differentiation of radial glial cells (By similarity).
Biological Process
Forebrain radial glial cell differentiation Source: UniProtKB
Gliogenesis Source: UniProtKB
mRNA catabolic process Source: Ensembl
mRNA destabilization Source: UniProtKB
mRNA methylation Source: UniProtKB
mRNA splicing, via spliceosome Source: UniProtKB
Negative regulation of hematopoietic progenitor cell differentiation Source: ARUK-UCL
Positive regulation of translation Source: ARUK-UCL
Spermatogenesis Source: UniProtKB
Stem cell population maintenance Source: UniProtKB
Cellular Location
Nucleus

Xie, Q., Li, Z., Luo, X., Wang, D., Zhou, Y., Zhao, J., ... & Sun, T. (2022). piRNA-14633 promotes cervical cancer cell malignancy in a METTL14-dependent m6A RNA methylation manner. Journal of Translational Medicine, 20(1), 51.

Guan, Q., Lin, H., Miao, L., Guo, H., Chen, Y., Zhuo, Z., & He, J. (2022). Functions, mechanisms, and therapeutic implications of METTL14 in human cancer. Journal of hematology & oncology, 15(1), 1-15.

Liu, X., Du, Y., Huang, Z., Qin, H., Chen, J., & Zhao, Y. (2022). Insights into roles of METTL14 in tumors. Cell proliferation, 55(1), e13168.

Liu, X., Xiao, M., Zhang, L., Li, L., Zhu, G., Shen, E., ... & Sun, Z. (2021). The m6A methyltransferase METTL14 inhibits the proliferation, migration, and invasion of gastric cancer by regulating the PI3K/AKT/mTOR signaling pathway. Journal of clinical laboratory analysis, 35(3), e23655.

Zhou, H., Yin, K., Zhang, Y., Tian, J., & Wang, S. (2021). The RNA m6A writer METTL14 in cancers: Roles, structures, and applications. Biochimica et Biophysica Acta (BBA)-Reviews on Cancer, 1876(2), 188609.

Liu, P., Li, F., Lin, J., Fukumoto, T., Nacarelli, T., Hao, X., ... & Zhang, R. (2021). m6A-independent genome-wide METTL3 and METTL14 redistribution drives the senescence-associated secretory phenotype. Nature cell biology, 23(4), 355-365.

Liu, X., Qin, J., Gao, T., Li, C., Chen, X., Zeng, K., ... & Wang, S. (2020). Analysis of METTL3 and METTL14 in hepatocellular carcinoma. Aging (Albany NY), 12(21), 21638.

Yang, X., Zhang, S., He, C., Xue, P., Zhang, L., He, Z., ... & Zheng, M. (2020). METTL14 suppresses proliferation and metastasis of colorectal cancer by down-regulating oncogenic long non-coding RNA XIST. Molecular cancer, 19, 1-16.

Wang, M., Liu, J., Zhao, Y., He, R., Xu, X., Guo, X., ... & Qin, R. (2020). Upregulation of METTL14 mediates the elevation of PERP mRNA N6 adenosine methylation promoting the growth and metastasis of pancreatic cancer. Molecular cancer, 19(1), 1-15.

Huang, J., Dong, X., Gong, Z., Qin, L. Y., Yang, S., Zhu, Y. L., ... & Tang, C. (2019). Solution structure of the RNA recognition domain of METTL3-METTL14 N6-methyladenosine methyltransferase. Protein & cell, 10(4), 272-284.

Ask a question We look forward to hearing from you.
0 reviews or Q&As
Loading...
Have you used Mouse Anti-METTL14 Recombinant Antibody (CBFYM-2122)?
Submit a review and get a Coupon or an Amazon gift card. 20% off Coupon $30 eGift Card
Submit a review
Loading...
For research use only. Not intended for any clinical use.

Custom Antibody Labeling

We also offer labeled antibodies developed using our catalog antibody products and nonfluorescent conjugates (HRP, AP, Biotin, etc.) or fluorescent conjugates (Alexa Fluor, FITC, TRITC, Rhodamine, Texas Red, R-PE, APC, Qdot Probes, Pacific Dyes, etc.).

Online Inquiry

Contact us

  • Tel: (USA)
  • (UK)
  • Fax:
  • Email:

Submit A Review

online inquiry
Online Inquiry
Happy Holidays
Happy Holidays close ad