Mouse Anti-TREM2 Recombinant Antibody (CBYJT-4609) (CBMAB-T4136-YJ)

Go to compare Compare Online Inquiry
Request for COA
Datasheet Target Q & As Review & reward Protocols Associated Products

Basic Information

Host Animal
Mouse
Clone
CBYJT-4609
Application
WB
Immunogen
Recombinant fragment corresponding to Human TREM2 aa 19-173. Sequence: HNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHN LWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEA DTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEI PFPPT
Specificity
Human
Antibody Isotype
IgG1
Clonality
Monoclonal
Application Notes
The COA includes recommended starting dilutions, optimal dilutions should be determined by the end user.

Formulations & Storage [For reference only, actual COA shall prevail!]

Buffer
PBS, pH 7.4
Storage
Store at 4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze/thaw cycles.
Epitope
aa 19-173
More Infomation

Target

Full Name
TREM2 Gene(Protein Coding) Triggering Receptor Expressed On Myeloid Cells 2
Introduction
TREM2 is a membrane protein that forms a receptor signaling complex with the TYRO protein tyrosine kinase binding protein. TREM2 functions in immune response and may be involved in chronic inflammation by triggering the production of constitutive inflammatory cytokines. Defects in this gene are a cause of polycystic lipomembranous osteodysplasia with sclerosing leukoencephalopathy (PLOSL).
Entrez Gene ID
UniProt ID
Alternative Names
Triggering Receptor Expressed On Myeloid Cells 2; Triggering Receptor Expressed On Myeloid Cells 2a; Triggering Receptor Expressed On Monocytes 2; TREM-2; Trem2a; Trem2b; Trem2c
Function
Forms a receptor signaling complex with TYROBP which mediates signaling and cell activation following ligand binding (PubMed:10799849).
Acts as a receptor for amyloid-beta protein 42, a cleavage product of the amyloid-beta precursor protein APP, and mediates its uptake and degradation by microglia (PubMed:27477018, PubMed:29518356).
Binding to amyloid-beta 42 mediates microglial activation, proliferation, migration, apoptosis and expression of pro-inflammatory cytokines, such as IL6R and CCL3, and the anti-inflammatory cytokine ARG1 (By similarity).
Acts as a receptor for lipoprotein particles such as LDL, VLDL, and HDL and for apolipoproteins such as APOA1, APOA2, APOB, APOE, APOE2, APOE3, APOE4, and CLU and enhances their uptake in microglia (PubMed:27477018).
Binds phospholipids (preferably anionic lipids) such as phosphatidylserine, phosphatidylethanolamine, phosphatidylglycerol and sphingomyelin (PubMed:29794134).
Regulates microglial proliferation by acting as an upstream regulator of the Wnt/beta-catenin signaling cascade (By similarity).
Required for microglial phagocytosis of apoptotic neurons (PubMed:24990881).
Also required for microglial activation and phagocytosis of myelin debris after neuronal injury and of neuronal synapses during synapse elimination in the developing brain (By similarity).
Regulates microglial chemotaxis and process outgrowth, and also the microglial response to oxidative stress and lipopolysaccharide (By similarity).
It suppresses PI3K and NF-kappa-B signaling in response to lipopolysaccharide; thus promoting phagocytosis, suppressing pro-inflammatory cytokine and nitric oxide production, inhibiting apoptosis and increasing expression of IL10 and TGFB (By similarity).
During oxidative stress, it promotes anti-apoptotic NF-kappa-B signaling and ERK signaling (By similarity).
Plays a role in microglial MTOR activation and metabolism (By similarity).
Regulates age-related changes in microglial numbers (PubMed:29752066).
Triggers activation of the immune responses in macrophages and dendritic cells (PubMed:10799849).
Mediates cytokine-induced formation of multinucleated giant cells which are formed by the fusion of macrophages (By similarity).
In dendritic cells, it mediates up-regulation of chemokine receptor CCR7 and dendritic cell maturation and survival (PubMed:11602640).
Involved in the positive regulation of osteoclast differentiation (PubMed:12925681).
Biological Process
Biological Process amyloid-beta clearance by cellular catabolic process Source:ARUK-UCL1 Publication
Biological Process apoptotic cell clearance Source:UniProtKB
Biological Process astrocyte activation Source:ARUK-UCL
Biological Process cellular response to amyloid-beta Source:ARUK-UCLBy Similarity
Biological Process cellular response to glucose stimulus Source:Ensembl
Biological Process cellular response to hypoxia Source:Ensembl
Biological Process cellular response to lipid Source:ARUK-UCL1 Publication
Biological Process cellular response to lipoteichoic acid Source:Ensembl
Biological Process cellular response to oxidised low-density lipoprotein particle stimulus Source:ARUK-UCL1 Publication
Biological Process cellular response to peptidoglycan Source:Ensembl
Biological Process complement-mediated synapse pruning Source:ARUK-UCL
Biological Process CXCL12-activated CXCR4 signaling pathway Source:ARUK-UCL1 Publication
Biological Process defense response to Gram-negative bacterium Source:ARUK-UCL
Biological Process dendritic cell differentiation Source:BHF-UCL1 Publication
Biological Process dendritic spine maintenance Source:ARUK-UCL
Biological Process detection of lipopolysaccharide Source:Ensembl
Biological Process detection of lipoteichoic acid Source:Ensembl
Biological Process detection of peptidoglycan Source:Ensembl
Biological Process excitatory synapse pruning Source:ARUK-UCL
Biological Process humoral immune response Source:ProtInc1 Publication
Biological Process import into cell Source:ARUK-UCL
Biological Process lipid homeostasis Source:ARUK-UCL
Biological Process memory Source:ARUK-UCL1 Publication
Biological Process microglial cell activation Source:ARUK-UCLBy Similarity
Biological Process microglial cell activation involved in immune response Source:ARUK-UCL
Biological Process microglial cell proliferation Source:ARUK-UCL
Biological Process negative regulation of amyloid fibril formation Source:ARUK-UCL
Biological Process negative regulation of astrocyte activation Source:ARUK-UCL
Biological Process negative regulation of autophagic cell death Source:ARUK-UCL
Biological Process negative regulation of autophagy Source:ARUK-UCL
Biological Process negative regulation of cell activation Source:ARUK-UCL
Biological Process negative regulation of cholesterol storage Source:ARUK-UCL
Biological Process negative regulation of cytokine production involved in inflammatory response Source:ARUK-UCL
Biological Process negative regulation of fat cell proliferation Source:ARUK-UCL
Biological Process negative regulation of glial cell apoptotic process Source:ARUK-UCL
Biological Process negative regulation of I-kappaB kinase/NF-kappaB signaling Source:ARUK-UCL
Biological Process negative regulation of inflammatory response to antigenic stimulus Source:ARUK-UCL
Biological Process negative regulation of interleukin-1 beta production Source:Ensembl
Biological Process negative regulation of macrophage colony-stimulating factor signaling pathway Source:ARUK-UCL1 Publication
Biological Process negative regulation of neuroinflammatory response Source:ARUK-UCL1 Publication
Biological Process negative regulation of NLRP3 inflammasome complex assembly Source:ARUK-UCL1 Publication
Biological Process negative regulation of p38MAPK cascade Source:ARUK-UCL
Biological Process negative regulation of phosphatidylinositol 3-kinase signaling Source:ARUK-UCL
Biological Process negative regulation of sequestering of triglyceride Source:ARUK-UCL
Biological Process negative regulation of toll-like receptor 2 signaling pathway Source:ARUK-UCL
Biological Process negative regulation of toll-like receptor 4 signaling pathway Source:ARUK-UCL
Biological Process negative regulation of tumor necrosis factor production Source:Ensembl
Biological Process osteoclast differentiation Source:UniProtKB1 Publication
Biological Process phagocytosis, engulfment Source:Ensembl
Biological Process phagocytosis, recognition Source:ARUK-UCL1 Publication
Biological Process positive regulation of amyloid-beta clearance Source:ARUK-UCL1 Publication
Biological Process positive regulation of antigen processing and presentation of peptide antigen via MHC class II Source:BHF-UCL1 Publication
Biological Process positive regulation of ATP biosynthetic process Source:ARUK-UCL
Biological Process positive regulation of C-C chemokine receptor CCR7 signaling pathway Source:BHF-UCL1 Publication
Biological Process positive regulation of calcium-mediated signaling Source:BHF-UCL1 Publication
Biological Process positive regulation of CAMKK-AMPK signaling cascade Source:ARUK-UCL
Biological Process positive regulation of CD40 signaling pathway Source:BHF-UCL1 Publication
Biological Process positive regulation of chemotaxis Source:ARUK-UCL
Biological Process positive regulation of cholesterol efflux Source:ARUK-UCL
Biological Process positive regulation of complement activation, classical pathway Source:ARUK-UCL
Biological Process positive regulation of engulfment of apoptotic cell Source:UniProtKB1 Publication
Biological Process positive regulation of ERK1 and ERK2 cascade Source:BHF-UCL1 Publication
Biological Process positive regulation of establishment of protein localization Source:ARUK-UCL
Biological Process positive regulation of gene expression Source:ARUK-UCL1 Publication
Biological Process positive regulation of high-density lipoprotein particle clearance Source:ARUK-UCL
Biological Process positive regulation of interleukin-10 production Source:Ensembl
Biological Process positive regulation of inward rectifier potassium channel activity Source:ARUK-UCLBy Similarity
Biological Process positive regulation of kinase activity Source:ARUK-UCL1 Publication
Biological Process positive regulation of low-density lipoprotein particle clearance Source:ARUK-UCL
Biological Process positive regulation of macrophage fusion Source:UniProtKB
Biological Process positive regulation of microglial cell activation Source:UniProtKB1 Publication
Biological Process positive regulation of microglial cell migration Source:ARUK-UCL1 Publication
Biological Process positive regulation of mitochondrion organization Source:ARUK-UCL
Biological Process positive regulation of NIK/NF-kappaB signaling Source:Ensembl
Biological Process positive regulation of osteoclast differentiation Source:Ensembl
Biological Process positive regulation of peptidyl-tyrosine phosphorylation Source:BHF-UCL2 Publications
Biological Process positive regulation of phagocytosis Source:ARUK-UCL1 Publication
Biological Process positive regulation of phagocytosis, engulfment Source:UniProtKB1 Publication
Biological Process positive regulation of phosphatidylinositol 3-kinase signaling Source:ARUK-UCL
Biological Process positive regulation of proteasomal protein catabolic process Source:ARUK-UCLBy Similarity
Biological Process positive regulation of protein localization to plasma membrane Source:BHF-UCL1 Publication
Biological Process positive regulation of protein phosphorylation Source:ARUK-UCLBy Similarity
Biological Process positive regulation of protein secretion Source:UniProtKB1 Publication
Biological Process positive regulation of synapse pruning Source:ARUK-UCL1 Publication
Biological Process positive regulation of TOR signaling Source:ARUK-UCL
Biological Process pyroptosis Source:ARUK-UCL
Biological Process regulation of cytokine production involved in inflammatory response Source:ARUK-UCL
Biological Process regulation of gene expression Source:ARUK-UCLBy Similarity
Biological Process regulation of hippocampal neuron apoptotic process Source:ARUK-UCL
Biological Process regulation of innate immune response Source:ARUK-UCL
Biological Process regulation of interleukin-6 production Source:ARUK-UCLBy Similarity
Biological Process regulation of intracellular signal transduction Source:ARUK-UCLBy Similarity
Biological Process regulation of lipid metabolic process Source:ARUK-UCL1 Publication
Biological Process regulation of macrophage inflammatory protein 1 alpha production Source:ARUK-UCLBy Similarity
Biological Process regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway Source:ARUK-UCL
Biological Process regulation of peptidyl-tyrosine phosphorylation Source:ARUK-UCLBy Similarity
Biological Process regulation of plasma membrane bounded cell projection organization Source:ARUK-UCL1 Publication
Biological Process regulation of resting membrane potential Source:ARUK-UCLBy Similarity
Biological Process regulation of toll-like receptor 6 signaling pathway Source:ARUK-UCL
Biological Process regulation of TOR signaling Source:ARUK-UCL
Biological Process respiratory burst after phagocytosis Source:ARUK-UCL
Biological Process response to axon injury Source:ARUK-UCL2 Publications
Biological Process response to ischemia Source:Ensembl
Biological Process social behavior Source:ARUK-UCL1 Publication
Cellular Location
Isoform 1
Cell membrane
Isoform 2
Secreted
Isoform 3
Secreted
Involvement in disease
Polycystic lipomembranous osteodysplasia with sclerosing leukoencephalopathy 2 (PLOSL2):
An autosomal recessive disease characterized by presenile frontal dementia with leukoencephalopathy and basal ganglia calcification. In most cases the disorder first manifests in early adulthood as pain and swelling in ankles and feet, followed by bone fractures. Neurologic symptoms manifest in the fourth decade of life as a frontal lobe syndrome with loss of judgment, euphoria, and disinhibition. Progressive decline in other cognitive domains begins to develop at about the same time. The disorder culminates in a profound dementia and death by age 50 years.
Topology
Extracellular: 19-174
Helical: 175-195
Cytoplasmic: 196-230
PTM
Undergoes ectodomain shedding through proteolytic cleavage by ADAM10 and ADAM17 to produce a transmembrane segment, the TREM2 C-terminal fragment (TREM2-CTF), which is subsequently cleaved by gamma-secretase.
Ask a question We look forward to hearing from you.
0 reviews or Q&As
Loading...
Have you used Mouse Anti-TREM2 Recombinant Antibody (CBYJT-4609)?
Submit a review and get a Coupon or an Amazon gift card. 20% off Coupon $30 eGift Card
Submit a review
Loading...
For research use only. Not intended for any clinical use.

Custom Antibody Labeling

We also offer labeled antibodies developed using our catalog antibody products and nonfluorescent conjugates (HRP, AP, Biotin, etc.) or fluorescent conjugates (Alexa Fluor, FITC, TRITC, Rhodamine, Texas Red, R-PE, APC, Qdot Probes, Pacific Dyes, etc.).

Online Inquiry

Contact us

  • Tel: (USA)
  • (UK)
  • Fax:
  • Email:

Submit A Review

online inquiry
Online Inquiry

This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.