Mouse Anti-CDKN2B Recombinant Antibody (CBYY-C1811) (CBMAB-C3249-YY)

Go to compare Compare Online Inquiry
Request for COA
Datasheet Target References Q & As Review & reward Protocols Associated Products

Basic Information

Host Animal
Mouse
Clone
CBYY-C1811
Application
ELISA, WB
Immunogen
MREENKGIPSGGGSDEGLASAAARGLVEKVRQLLEAGADP NGVNRFGRRAIQVMMMGSARVAELLLLHGAEPNCADPATL TRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLA EERGHRDVAGYLRTATGD
Host Species
Mouse
Specificity
Human
Antibody Isotype
IgG2a, κ
Clonality
Monoclonal Antibody
Application Notes
The COA includes recommended starting dilutions, optimal dilutions should be determined by the end user.

Formulations & Storage [For reference only, actual COA shall prevail!]

Format
Liquid
Buffer
1 mg/mL
Preservative
50% glycerol, 1% BSA, PBS, pH 7.3
Concentration
Batch dependent
Storage
Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze/thaw cycles.
More Infomation

Target

Full Name
cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4)
Entrez Gene ID
UniProt ID
Alternative Names
Carcinoembryonic Antigen Related Cell Adhesion Molecule 3; Carcinoembryonic Antigen-Related Cell Adhesion Molecule 3; Carcinoembryonic Antigen CGM1; CD66d Antigen; CD66D; CGM1;
Function
Interacts strongly with CDK4 and CDK6. Potent inhibitor. Potential effector of TGF-beta induced cell cycle arrest.
Biological Process
Cell cycle arrest Source: BHF-UCL
Cellular response to extracellular stimulus Source: BHF-UCL
Cellular response to nutrient Source: BHF-UCL
Cellular senescence Source: BHF-UCL
G2/M transition of mitotic cell cycle Source: BHF-UCL
Megakaryocyte differentiation Source: UniProtKB
Negative regulation of cell population proliferation Source: BHF-UCL
Negative regulation of epithelial cell proliferation Source: BHF-UCL
Negative regulation of G1/S transition of mitotic cell cycle Source: Reactome
Negative regulation of phosphorylation Source: BHF-UCL
Positive regulation of transcription by RNA polymerase II Source: Reactome
Positive regulation of transforming growth factor beta receptor signaling pathway Source: BHF-UCL
Regulation of cyclin-dependent protein serine/threonine kinase activity Source: BHF-UCL
Regulation of G0 to G1 transition Source: BHF-UCL
Spleen development Source: Ensembl
Cellular Location
Cytoplasm. Also found in the nucleus.

Yang, W., Zhang, A., Han, Y., Su, X., Chen, Y., Zhao, W., ... & Jin, W. (2021). Cyclin-Dependent Kinase Inhibitor 2b Controls Fibrosis and Functional Changes in Ischemia-Induced Heart Failure via the BMI1-p15-Rb Signalling Pathway. Canadian Journal of Cardiology, 37(4), 655-664.

Zheng, Y., Zeng, J., Xia, H., Wang, X., Chen, H., Huang, L., & Zeng, C. (2021). Upregulated lncRNA Cyclin-dependent kinase inhibitor 2B antisense RNA 1 induces the proliferation and migration of colorectal cancer by miR-378b/CAPRIN2 axis. Bioengineered, 12(1), 5476-5490.

Liu, Y., Li, Y. F., Liu, J., Deng, Z. G., Zeng, L., & Zhou, W. B. (2021). Long Noncoding RNA GAS5 Targeting miR-221-3p/Cyclin-Dependent Kinase Inhibitor 2B Axis Regulates Follicular Thyroid Carcinoma Cell Cycle and Proliferation. Pathobiology, 1-12.

Ma, H., & Dong, A. (2021). Long non‑coding RNA cyclin‑dependent kinase inhibitor 2B antisense ribonucleic acid 1 is associated with in‑stent restenosis and promotes human carotid artery smooth muscle cell proliferation and migration by sponging miR‑143‑3p. Experimental and Therapeutic Medicine, 21(3), 1-1.

Kattan, S. W., Hobani, Y. H., Shaheen, S., Mokhtar, S. H., Hussein, M. H., Toraih, E. A., ... & Abdalla, H. A. (2021). Association of cyclin-dependent kinase inhibitor 2B antisense RNA 1 gene expression and rs2383207 variant with breast cancer risk and survival. Cellular & molecular biology letters, 26(1), 1-25.

Chen, X., Jiang, D., Xu, L., Han, L., Hu, H., Huang, Y., ... & Duan, S. (2019). Elevated methylation of cyclin dependent kinase inhibitor 2B contributes to the risk of coronary heart disease in women. Experimental and therapeutic medicine, 17(1), 205-213.

Weng, X., Zeng, L., Yan, F., He, M., Wu, X., & Zheng, D. (2019). Cyclin-dependent kinase inhibitor 2B gene is associated with the sensitivity of hepatoma cells to Sorafenib. OncoTargets and therapy, 12, 5025.

Tawarayama, H., Feng, Q., Murayama, N., Suzuki, N., & Nakazawa, T. (2019). Cyclin-dependent kinase inhibitor 2b mediates excitotoxicity-induced death of retinal ganglion cells. Investigative ophthalmology & visual science, 60(13), 4479-4488.

Akinyemi, R., Arnett, D. K., Tiwari, H. K., Ovbiagele, B., Sarfo, F., Srinivasasainagendra, V., ... & SIREN Investigators. (2017). Interleukin–6 (IL-6) rs1800796 and cyclin dependent kinase inhibitor (CDKN2A/CDKN2B) rs2383207 are associated with ischemic stroke in indigenous West African Men. Journal of the neurological sciences, 379, 229-235.

Gao, P., Si, J., Yang, B., & Yu, J. (2017). Upregulation of MicroRNA-15a contributes to pathogenesis of abdominal aortic aneurysm (AAA) by modulating the expression of cyclin-dependent kinase inhibitor 2B (CDKN2B). Medical science monitor: international medical journal of experimental and clinical research, 23, 881.

Ask a question We look forward to hearing from you.
0 reviews or Q&As
Loading...
Have you used Mouse Anti-CDKN2B Recombinant Antibody (CBYY-C1811)?
Submit a review and get a Coupon or an Amazon gift card. 20% off Coupon $30 eGift Card
Submit a review
Loading...
For research use only. Not intended for any clinical use.

Custom Antibody Labeling

We also offer labeled antibodies developed using our catalog antibody products and nonfluorescent conjugates (HRP, AP, Biotin, etc.) or fluorescent conjugates (Alexa Fluor, FITC, TRITC, Rhodamine, Texas Red, R-PE, APC, Qdot Probes, Pacific Dyes, etc.).

Online Inquiry

Contact us

  • Tel: (USA)
  • (UK)
  • Fax:
  • Email:

Submit A Review

online inquiry
Online Inquiry

This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.