Mouse Anti-MST1R Recombinant Antibody (CBFYM-2684) (CBMAB-M2873-FY)

Go to compare Compare Online Inquiry
Request for COA
Datasheet Target References Q & As Review & reward Protocols Associated Products

Basic Information

Host Animal
Mouse
Clone
CBFYM-2684
Application
WB
Immunogen
Recombinant protein corresponding to amino acids: EDPVVLSISPNCGYINSHITICGQHLTSAWHLVLSFHDGLRAVESRCERQLPEQQLCRLPEYVVRDPQGWVAGNLSARGDGAAGFTLPGFRFLPPPHPPSANLVPLKP
Specificity
Human
Antibody Isotype
IgG1
Clonality
Monoclonal
Application Notes
The COA includes recommended starting dilutions, optimal dilutions should be determined by the end user.

Formulations & Storage [For reference only, actual COA shall prevail!]

Format
Liquid
Storage
Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze/thaw cycles.
More Infomation

Target

Full Name
Macrophage Stimulating 1 Receptor
Introduction
This gene encodes a cell surface receptor for macrophage-stimulating protein with tyrosine kinase activity. The mature form of this protein is a heterodimer of disulfide-linked alpha and beta subunits, generated by proteolytic cleavage of a single-chain precursor. The beta subunit undergoes tyrosine phosphorylation upon stimulation by MSP. This protein is expressed on the ciliated epithelia of the mucociliary transport apparatus of the lung, and together with MSP, thought to be involved in host defense. Alternative splicing generates multiple transcript variants encoding different isoforms that may undergo similar proteolytic processing.
Entrez Gene ID
UniProt ID
Alternative Names
Macrophage Stimulating 1 Receptor; PTK8 Protein Tyrosine Kinase 8; C-Met-Related Tyrosine Kinase; MSP Receptor; EC 2.7.10.1; P185-Ron; CDw136; PTK8
Function
Receptor tyrosine kinase that transduces signals from the extracellular matrix into the cytoplasm by binding to MST1 ligand. Regulates many physiological processes including cell survival, migration and differentiation. Ligand binding at the cell surface induces autophosphorylation of RON on its intracellular domain that provides docking sites for downstream signaling molecules. Following activation by ligand, interacts with the PI3-kinase subunit PIK3R1, PLCG1 or the adapter GAB1. Recruitment of these downstream effectors by RON leads to the activation of several signaling cascades including the RAS-ERK, PI3 kinase-AKT, or PLCgamma-PKC. RON signaling activates the wound healing response by promoting epithelial cell migration, proliferation as well as survival at the wound site. Plays also a role in the innate immune response by regulating the migration and phagocytic activity of macrophages. Alternatively, RON can also promote signals such as cell migration and proliferation in response to growth factors other than MST1 ligand.
Biological Process
Cell migration Source: GO_Central
Defense response Source: ProtInc
Innate immune response Source: UniProtKB-KW
Nervous system development Source: GO_Central
Phagocytosis Source: GO_Central
Positive regulation of cell population proliferation Source: ProtInc
Positive regulation of kinase activity Source: GO_Central
Positive regulation of MAP kinase activity Source: UniProtKB
Positive regulation of protein kinase B signaling Source: UniProtKB
Response to virus Source: UniProtKB
Signal transduction Source: ProtInc
Single fertilization Source: ProtInc
Transmembrane receptor protein tyrosine kinase signaling pathway Source: GO_Central
Cellular Location
Membrane
Involvement in disease
Nasopharyngeal carcinoma, 3 (NPCA3):
A form of nasopharyngeal carcinoma, a malignant neoplasm that originates in the nasopharyngeal epithelium and includes 4 subtypes: keratinizing squamous cell, non-keratinizing, basaloid squamous cell, and papillary adenocarcinoma.
Topology
Extracellular: 25-957
Helical: 958-978
Cytoplasmic: 979-1400
PTM
Proteolytic processing yields the two subunits.
Autophosphorylated in response to ligand binding on Tyr-1238 and Tyr-1239 in the kinase domain leading to further phosphorylation of Tyr-1353 and Tyr-1360 in the C-terminal multifunctional docking site.
Ubiquitinated. Ubiquitination by CBL regulates the receptor stability and activity through proteasomal degradation.

Kim, J., Koh, D. I., Lee, M., Park, Y. S., Hong, S. W., Shin, J. S., ... & Jin, D. H. (2023). Targeting isoforms of RON kinase (MST1R) drives antitumor efficacy. Cell Death & Differentiation, 30(12), 2491-2507.

Hunt, B. G., Jones, A., Lester, C., Davis, J. C., Benight, N. M., & Waltz, S. E. (2022). RON (MST1R) and HGFL (MST1) co-overexpression supports breast tumorigenesis through autocrine and paracrine cellular crosstalk. Cancers, 14(10), 2493.

Qiu, S., Hu, Y., Zou, Q., & Liu, G. (2022). Genetic variant rs9848497 up-regulates MST1R expression, thereby influencing leadership phenotypes. Proceedings of the National Academy of Sciences, 119(29), e2207847119.

Robert, C., Marquevielle, J., & Salgado, G. F. (2022). The promoter region of the proto-oncogene MST1R contains the main features of G-quadruplexes formation. International Journal of Molecular Sciences, 23(21), 12905.

Cazes, A., Childers, B. G., Esparza, E., & Lowy, A. M. (2022). The MST1R/RON tyrosine kinase in cancer: oncogenic functions and therapeutic strategies. Cancers, 14(8), 2037.

Zhou, D., Zhu, X., Wu, X., Zheng, J., Tou, L., & Zhou, Y. (2021). The effect of splicing MST1R in gastric cancer was enhanced by lncRNA FENDRR. Experimental and Therapeutic Medicine, 22(2), 1-9.

Yoon, J. Y., Wang, J. Y., & Roehrl, M. H. (2020). A combined FAK, c-MET, and MST1R three-protein panel risk-stratifies colorectal cancer patients. Translational Oncology, 13(11), 100836.

Hunt, B. G., Wicker, C. A., Bourn, J. R., Lower, E. E., Takiar, V., & Waltz, S. E. (2020). MST1R (RON) expression is a novel prognostic biomarker for metastatic progression in breast cancer patients. Breast cancer research and treatment, 181, 529-540.

Gupta, A., Yadav, S., Pt, A., Mishra, J., Samaiya, A., Panday, R. K., & Shukla, S. (2020). The HNRNPA2B1–MST1R–Akt axis contributes to epithelial-to-mesenchymal transition in head and neck cancer. Laboratory Investigation, 100(12), 1589-1601.

Babicky, M. L., Harper, M. M., Chakedis, J., Cazes, A., Mose, E. S., Jaquish, D. V., ... & Lowy, A. M. (2019). MST1R kinase accelerates pancreatic cancer progression via effects on both epithelial cells and macrophages. Oncogene, 38(28), 5599-5611.

Ask a question We look forward to hearing from you.
0 reviews or Q&As
Loading...
Have you used Mouse Anti-MST1R Recombinant Antibody (CBFYM-2684)?
Submit a review and get a Coupon or an Amazon gift card. 20% off Coupon $30 eGift Card
Submit a review
Loading...
For research use only. Not intended for any clinical use.

Custom Antibody Labeling

We also offer labeled antibodies developed using our catalog antibody products and nonfluorescent conjugates (HRP, AP, Biotin, etc.) or fluorescent conjugates (Alexa Fluor, FITC, TRITC, Rhodamine, Texas Red, R-PE, APC, Qdot Probes, Pacific Dyes, etc.).

Online Inquiry

Contact us

  • Tel: (USA)
  • (UK)
  • Fax:
  • Email:

Submit A Review

online inquiry
Online Inquiry

This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.