Search :
Sign in or Register  
Welcome Sign in or Don't have an account?Register

Mouse Anti-TCP1 Recombinant Antibody (2E8) (CBMAB-BR467LY)

Online Inquiry

Summary

Host Animal
Mouse
Specificity
Human
Clone
2E8
Antibody Isotype
IgG1
Application
FC: 1-3 μg/1x10 cells

Basic Information

Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human TCP1 alpha (515-551aa KFATEAAITILRIDDLIKLHPESKDDKHGSYEDAVHS), different from the related mouse sequence by one amino acid, and from the related rat sequence by two amino acids.
Specificity
Human
Antibody Isotype
IgG1
Clonality
Monoclonal
Application Notes
The COA includes recommended starting dilutions, optimal dilutions should be determined by the end user.

Formulations & Storage [For reference only, actual COA shall prevail!]

Format
Liquid
Buffer
50% glycerol
Preservative
0.02% sodium azide
Storage
Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freezethaw cycles.

Target

Full Name
t-complex 1
Introduction
The protein encoded by this gene is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternate transcriptional splice variants of this gene, encoding different isoforms, have been characterized. In addition, three pseudogenes that appear to be derived from this gene have been found. [provided by RefSeq, Jun 2010]
Entrez Gene ID
UniProt ID
Alternative Names
T-complex protein 1 subunit alpha; TCP-1-alpha; CCT-alpha; TCP1; CCT1; CCTA
Function
Component of the chaperonin-containing T-complex (TRiC), a molecular chaperone complex that assists the folding of proteins upon ATP hydrolysis (PubMed:25467444).
The TRiC complex mediates the folding of WRAP53/TCAB1, thereby regulating telomere maintenance (PubMed:25467444).
As part of the TRiC complex may play a role in the assembly of BBSome, a complex involved in ciliogenesis regulating transports vesicles to the cilia (PubMed:20080638).
The TRiC complex plays a role in the folding of actin and tubulin (Probable).
Biological Process
Biological Process binding of sperm to zona pellucidaIEA:Ensembl
Biological Process chaperone-mediated protein foldingIDA:ComplexPortal1 Publication
Biological Process positive regulation of establishment of protein localization to telomereIMP:BHF-UCL1 Publication
Biological Process positive regulation of protein localization to Cajal bodyHMP:BHF-UCL1 Publication
Biological Process positive regulation of telomerase activityIMP:BHF-UCL1 Publication
Biological Process positive regulation of telomerase RNA localization to Cajal bodyIMP:BHF-UCL1 Publication
Biological Process positive regulation of telomere maintenance via telomeraseIMP:BHF-UCL1 Publication
Biological Process protein foldingIDA:FlyBase1 Publication
Biological Process protein stabilizationIMP:BHF-UCL1 Publication
Biological Process regulation of macrophage apoptotic processIEA:Ensembl
Biological Process scaRNA localization to Cajal bodyIMP:BHF-UCL1 Publication
Biological Process toxin transportIEA:Ensembl
Biological Process translocation of peptides or proteins into host cell cytoplasmIEA:Ensembl
Biological Process tubulin complex assemblyNAS:UniProtKB1 Publication
Cellular Location
Cytoplasm, cytosol
Cytoplasm, cytoskeleton, microtubule organizing center, centrosome
More Infomation
Ask a question We look forward to hearing from you.
0 reviews or Q&As
Loading...
Have you used Mouse Anti-TCP1 Recombinant Antibody (2E8)?
Submit a review and get a Coupon or an Amazon gift card. 20% off Coupon $30 eGift Card
Submit a review
Loading...
For research use only. Not intended for any clinical use.

Custom Antibody Labeling

We also offer labeled antibodies developed using our catalog antibody products and nonfluorescent conjugates (HRP, AP, Biotin, etc.) or fluorescent conjugates (Alexa Fluor, FITC, TRITC, Rhodamine, Texas Red, R-PE, APC, Qdot Probes, Pacific Dyes, etc.).

Learn more

Documents

Contact us

  • Tel: (USA)
  • (UK)
  • Fax:
  • Email:

Submit A Review

Online Inquiry