Mouse Anti-CDK19 Recombinant Antibody (CBYY-C1757) (CBMAB-C3195-YY)

Go to compare Compare Online Inquiry
Request for COA
Datasheet Target References Q & As Review & reward Protocols Associated Products

Basic Information

Host Animal
Mouse
Clone
CBYY-C1757
Application
ELISA, IHC
Immunogen
MDYDFKAKLAAERERVEDLFEYEGCKVGRGTYGHVYKARR KDGKDEKEYALKQIEGTGISMSACREIALLRELKHPNVIA LQKVFLSHSDRKVWLLFDYAEHDLWHIIKFHRAS
Host Species
Mouse
Specificity
Human
Antibody Isotype
IgG2a, κ
Clonality
Monoclonal Antibody
Application Notes
The COA includes recommended starting dilutions, optimal dilutions should be determined by the end user.
ApplicationNote
IHC3 μg/ml

Formulations & Storage [For reference only, actual COA shall prevail!]

Format
Liquid
Buffer
1 mg/mL
Preservative
PBS, pH 7.4
Concentration
Batch dependent
Storage
Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze/thaw cycles.
More Infomation

Target

Full Name
Cyclin Dependent Kinase 19
Entrez Gene ID
UniProt ID
Alternative Names
Cyclin Dependent Kinase 7; Cyclin-Dependent Kinase 7 (MO15 Homolog, Xenopus Laevis, Cdk-Activating Kinase); TFIIH Basal Transcription Factor Complex Kinase Subunit; Cell Division Protein Kinase 7; CDK-Activating Kinase 1; 39 KDa Protein Kinase; EC 2.7.11.22; CDKN7; STK1; CAK1; MO15; CAK; Cyclin-Dependent Kinase 7 (Homolog Of Xenopus MO15 Cdk-Activating Kinase); Homolog Of Xenopus MO15 Cdk-Activating Kinase;
Biological Process
Cellular response to lipopolysaccharide Source: Ensembl
Positive regulation of apoptotic process Source: Ensembl
Positive regulation of inflammatory response Source: Ensembl
Protein phosphorylation Source: GO_Central
Cellular Location
Nucleus; Cytoplasm; Perinuclear region
Involvement in disease
Developmental and epileptic encephalopathy 87 (DEE87): A form of epileptic encephalopathy, a heterogeneous group of severe early-onset epilepsies characterized by refractory seizures, neurodevelopmental impairment, and poor prognosis. Development is normal prior to seizure onset, after which cognitive and motor delays become apparent. DEE87 inheritance is autosomal dominant.

Cai, X., Deng, J., Cai, H., & Chen, Z. (2021). Cyclin Dependent Kinase 19 Upregulation Correlates With Unfavorable Prognosis in Hepatocellular Carcinoma.

Butler, M., Chotiwan, N., Brewster, C. D., DiLisio, J. E., Ackart, D. F., Podell, B. K., ... & Rovnak, J. (2020). Cyclin-Dependent Kinases 8 and 19 Regulate Host Cell Metabolism during Dengue Virus Serotype 2 Infection. Viruses, 12(6), 654.

Dannappel, M. V., Sooraj, D., Loh, J. J., & Firestein, R. (2019). Molecular and in vivo functions of the CDK8 and CDK19 kinase modules. Frontiers in cell and developmental biology, 6, 171.

Fant, C. B., & Taatjes, D. J. (2019). Regulatory functions of the Mediator kinases CDK8 and CDK19. Transcription, 10(2), 76-90.

Amirhosseini, M., Bernhardsson, M., Lång, P., Andersson, G., Flygare, J., & Fahlgren, A. (2019). Cyclin‐dependent kinase 8/19 inhibition suppresses osteoclastogenesis by downregulating RANK and promotes osteoblast mineralization and cancellous bone healing. Journal of cellular physiology, 234(9), 16503-16516.

Chen, M., Hu, B., Ji, H., Altilia, S., Liang, J., McDermott, M., ... & Roninson, I. (2017). Functional characterization of novel transcription-regulating cancer drug targets, CDK8 and CDK19, using CRISPR/Cas9 knockout and a highly selective CDK8/19 kinase inhibitor.

Audetat, K. A., Galbraith, M. D., Odell, A. T., Lee, T., Pandey, A., Espinosa, J. M., ... & Taatjes, D. J. (2017). A kinase-independent role for cyclin-dependent kinase 19 in p53 response. Molecular and cellular biology, 37(13), e00626-16.

Ask a question We look forward to hearing from you.
0 reviews or Q&As
Loading...
Have you used Mouse Anti-CDK19 Recombinant Antibody (CBYY-C1757)?
Submit a review and get a Coupon or an Amazon gift card. 20% off Coupon $30 eGift Card
Submit a review
Loading...
For research use only. Not intended for any clinical use.

Custom Antibody Labeling

We also offer labeled antibodies developed using our catalog antibody products and nonfluorescent conjugates (HRP, AP, Biotin, etc.) or fluorescent conjugates (Alexa Fluor, FITC, TRITC, Rhodamine, Texas Red, R-PE, APC, Qdot Probes, Pacific Dyes, etc.).

Online Inquiry

Contact us

  • Tel: (USA)
  • (UK)
  • Fax:
  • Email:

Submit A Review

online inquiry
Online Inquiry
Happy Holidays
Happy Holidays close ad