Mouse Anti-FH Recombinant Antibody (9D8) (CBMAB-BR178LY)

Go to compare Compare Online Inquiry
Request for COA
Datasheet Target References Q & As Review & reward Protocols Associated Products

Basic Information

Host Animal
Mouse
Clone
9D8
Application
IHC: 1:300-1:500 dilution, WB: 0.1-0.5 μg/ml
Immunogen
A synthetic peptide corresponding to a sequence of human FH (YDKAAKIAKTAH KNGSTLKETAIELGYLTAEQFDEWVKPKDMLGPK).
Specificity
Human, Monkey, Mouse, Rat
Antibody Isotype
IgG2a
Clonality
Monoclonal
Application Notes
The COA includes recommended starting dilutions, optimal dilutions should be determined by the end user.

Formulations & Storage [For reference only, actual COA shall prevail!]

Format
Lyophilized
Preservative
0.05 mg sodium azide
Storage
Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freezethaw cycles.
More Infomation

Target

Full Name
Fumarate Hydratase
Introduction
The protein encoded by this gene is an enzymatic component of the tricarboxylic acid (TCA) cycle, or Krebs cycle, and catalyzes the formation of L-malate from fumarate. It exists in both a cytosolic form and an N-terminal extended form, differing only in the translation start site used. The N-terminal extended form is targeted to the mitochondrion, where the removal of the extension generates the same form as in the cytoplasm. It is similar to some thermostable class II fumarases and functions as a homotetramer. Mutations in this gene can cause fumarase deficiency and lead to progressive encephalopathy. [provided by RefSeq, Jul 2008]
Entrez Gene ID
Human2271
Mouse14193
Rat24368
Monkey707542
UniProt ID
HumanP07954
MouseP97807
RatP14408
MonkeyQ60HF9
Alternative Names
Fumarate hydratase, mitochondrial; Fumarase; FH;
Function
Catalyzes the reversible stereospecific interconversion of fumarate to L-malate (PubMed:30761759).

Experiments in other species have demonstrated that specific isoforms of this protein act in defined pathways and favor one direction over the other (Probable).

Isoform Mitochondrial:
Catalyzes the hydration of fumarate to L-malate in the tricarboxylic acid (TCA) cycle to facilitate a transition step in the production of energy in the form of NADH.

Isoform Cytoplasmic:
Catalyzes the dehydration of L-malate to fumarate (By similarity).

Fumarate metabolism in the cytosol plays a role during urea cycle and arginine metabolism; fumarate being a by-product of the urea cycle and amino-acid catabolism (By similarity).

Also plays a role in DNA repair by promoting non-homologous end-joining (NHEJ) (PubMed:20231875, PubMed:26237645).

In response to DNA damage and phosphorylation by PRKDC, translocates to the nucleus and accumulates at DNA double-strand breaks (DSBs): acts by catalyzing formation of fumarate, an inhibitor of KDM2B histone demethylase activity, resulting in enhanced dimethylation of histone H3 'Lys-36' (H3K36me2) (PubMed:26237645).
Biological Process
Cellular response to DNA damage stimulus Source: UniProtKB
DNA repair Source: UniProtKB-KW
Fumarate metabolic process Source: UniProtKB
Homeostasis of number of cells within a tissue Source: Ensembl
Malate metabolic process Source: UniProtKB
Negative regulation of histone H3-K36 methylation Source: UniProtKB
Positive regulation of cold-induced thermogenesis Source: YuBioLab
Positive regulation of double-strand break repair via nonhomologous end joining Source: UniProtKB
Regulation of arginine metabolic process Source: UniProtKB
Tricarboxylic acid cycle Source: GO_Central
Urea cycle Source: UniProtKB
Cellular Location
Isoform Mitochondrial: Mitochondrion
Isoform Cytoplasmic: Cytosol; Nucleus; Chromosome. Translocates to the nucleus in response to DNA damage: localizes to DNA double-strand breaks (DSBs) following phosphorylation by PRKDC.
Involvement in disease
Fumarase deficiency (FMRD):
A severe autosomal recessive metabolic disorder characterized by early-onset hypotonia, profound psychomotor retardation, and brain abnormalities, such as agenesis of the corpus callosum, gyral defects, and ventriculomegaly. Many patients show neonatal distress, metabolic acidosis, and/or encephalopathy.
Hereditary leiomyomatosis and renal cell cancer (HLRCC):
Isoform Cytoplasmic:
The disease is caused by variants affecting the gene represented in this entry. Isoform Cytoplasmic: HLRCC is probably caused by an accumulation of fumarate (PubMed:30718813). Accumulation of fumarate coupled with protonation promotes the formation of non-enzymatic post-translational modification cysteine S-succination (S-(2-succinyl)cysteine) on proteins, such as SMARCC1 (PubMed:30718813). A disorder characterized by predisposition to cutaneous and uterine leiomyomas, and papillary type 2 renal cancer which occurs in about 20% of patients.
PTM
Isoform Cytoplasmic:
Phosphorylation at Thr-236 by PRKDC in response to DNA damage promotes translocation to the nucleus and recruitment to DNA double-strand breaks (DSBs).

Hamza, A., Sirohi, D., Smith, S. C., & Amin, M. B. (2021). Low-grade oncocytic fumarate hydratase-deficient renal cell carcinoma: an update on biologic potential, morphologic spectrum, and differential diagnosis with other low-grade oncocytic tumors. Advances in Anatomic Pathology, 28(6), 396-407.

Sun, G., Zhang, X., Liang, J., Pan, X., Zhu, S., Liu, Z., ... & Zeng, H. (2021). Integrated Molecular Characterization of Fumarate Hydratase–deficient Renal Cell CarcinomaGenomic and Epigenomic Profiling of FH-deficient RCC. Clinical Cancer Research, 27(6), 1734-1743.

Gleeson, J. P., Nikolovski, I., Dinatale, R., Zucker, M., Knezevic, A., Patil, S., ... & Carlo, M. I. (2021). Comprehensive Molecular Characterization and Response to Therapy in Fumarate Hydratase–Deficient Renal Cell CarcinomaMolecular Analysis and Therapy Response in FH-Deficient RCC. Clinical Cancer Research, 27(10), 2910-2919.

Schmidt, C., Sciacovelli, M., & Frezza, C. (2020, February). Fumarate hydratase in cancer: A multifaceted tumour suppressor. In Seminars in cell & developmental biology (Vol. 98, pp. 15-25). Academic Press.

Kancherla, P., Daneshvar, M., Sager, R. A., Mollapour, M., & Bratslavsky, G. (2020). Fumarate hydratase as a therapeutic target in renal cancer. Expert Opinion on Therapeutic Targets, 24(9), 923-936.

Zhang, L., Walsh, M. F., Jairam, S., Mandelker, D., Zhong, Y., Kemel, Y., ... & Offit, K. (2020). Fumarate hydratase FH c. 1431_1433dupAAA (p. Lys477dup) variant is not associated with cancer including renal cell carcinoma. Human mutation, 41(1), 103-109.

Lau, H. D., Chan, E., Fan, A. C., Kunder, C. A., Williamson, S. R., Zhou, M., ... & Kao, C. S. (2020). A clinicopathologic and molecular analysis of fumarate hydratase-deficient renal cell carcinoma in 32 patients. The American Journal of Surgical Pathology, 44(1), 98-110.

Wyvekens, N., Valtcheva, N., Mischo, A., Helmchen, B., Hermanns, T., Choschzick, M., ... & Rupp, N. J. (2020). Novel morphological and genetic features of fumarate hydratase deficient renal cell carcinoma in HLRCC syndrome patients with a tailored therapeutic approach. Genes, Chromosomes and Cancer, 59(11), 611-619.

Gupta, S., Swanson, A. A., Chen, Y. B., Lopez, T., Milosevic, D., Kipp, B. R., ... & Jimenez, R. E. (2019). Incidence of succinate dehydrogenase and fumarate hydratase–deficient renal cell carcinoma based on immunohistochemical screening with SDHA/SDHB and FH/2SC. Human pathology, 91, 114-122.

Ask a question We look forward to hearing from you.
0 reviews or Q&As
Loading...
Have you used Mouse Anti-FH Recombinant Antibody (9D8)?
Submit a review and get a Coupon or an Amazon gift card. 20% off Coupon $30 eGift Card
Submit a review
Loading...
For research use only. Not intended for any clinical use.

Custom Antibody Labeling

We also offer labeled antibodies developed using our catalog antibody products and nonfluorescent conjugates (HRP, AP, Biotin, etc.) or fluorescent conjugates (Alexa Fluor, FITC, TRITC, Rhodamine, Texas Red, R-PE, APC, Qdot Probes, Pacific Dyes, etc.).

Online Inquiry

Contact us

  • Tel: (USA)
  • (UK)
  • Fax:
  • Email:

Submit A Review

online inquiry
Online Inquiry