Sign in or Register   Sign in or Register
  |  

Mouse Anti-GNAQ Recombinant Antibody (13H4) (CBMAB-BR188LY)

The product is antibody recognizes GNAQ. The antibody 13H4 immunoassay techniques such as: FC, IHC-P, WB.
See all GNAQ antibodies

Summary

Host Animal
Mouse
Specificity
Human, Monkey
Clone
13H4
Antibody Isotype
IgG2b
Application
FC: 1-3 μg/1x10 cells, IHC-P: 0.5-1 μg/ml, WB: 0.1-0.5 μg/ml

Basic Information

Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human GNAQ (102-138aa KYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWND), identical to the related mouse and rat sequences
Specificity
Human, Monkey
Antibody Isotype
IgG2b
Clonality
Monoclonal
Application Notes
The COA includes recommended starting dilutions, optimal dilutions should be determined by the end user.

Formulations & Storage [For reference only, actual COA shall prevail!]

Format
Lyophilized
Preservative
0.05 mg sodium azide
Storage
Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freezethaw cycles.

Target

Full Name
guanine nucleotide binding protein (G protein), q polypeptide
Introduction
This locus encodes a guanine nucleotide-binding protein. The encoded protein, an alpha subunit in the Gq class, couples a seven-transmembrane domain receptor to activation of phospolipase C-beta. Mutations at this locus have been associated with problems in platelet activation and aggregation. A related pseudogene exists on chromosome 2.[provided by RefSeq, Nov 2010]
Entrez Gene ID
Human2776
Monkey705680
UniProt ID
HumanP50148
MonkeyA0A2K5C845
Alternative Names
Guanine nucleotide-binding protein G(q) subunit alpha; Guanine nucleotide-binding protein alpha-q; GNAQ; GAQ
Function
Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. Regulates B-cell selection and survival and is required to prevent B-cell-dependent autoimmunity. Regulates chemotaxis of BM-derived neutrophils and dendritic cells (in vitro) (By similarity).

Transduces FFAR4 signaling in response to long-chain fatty acids (LCFAs).
Biological Process
Action potential Source: GO_Central
Activation of phospholipase C activity Source: ProtInc
Adenylate cyclase-activating G protein-coupled receptor signaling pathway Source: GO_Central
Adenylate cyclase-modulating G protein-coupled receptor signaling pathway Source: GO_Central
Blood coagulation Source: ProtInc
Entrainment of circadian clock Source: AgBase
Glutamate receptor signaling pathway Source: GO_Central
G protein-coupled acetylcholine receptor signaling pathway Source: AgBase
Negative regulation of protein kinase activity Source: BHF-UCL
Phototransduction, visible light Source: AgBase
Protein stabilization Source: BHF-UCL
Regulation of canonical Wnt signaling pathway Source: BHF-UCL
Cellular Location
Cell membrane; Nucleus; Nucleus membrane; Golgi apparatus. Colocalizes with the adrenergic receptors, ADREN1A and ADREN1B, at the nuclear membrane of cardiac myocytes.
Involvement in disease
Capillary malformations, congenital (CMC):
A form of vascular malformations that are present from birth, tend to grow with the individual, do not regress spontaneously, and show normal rates of endothelial cell turnover. Capillary malformations are distinct from capillary hemangiomas, which are highly proliferative lesions that appear shortly after birth and show rapid growth, slow involution, and endothelial hypercellularity.
Sturge-Weber syndrome (SWS):
A syndrome characterized by an intracranial vascular anomaly, leptomeningeal angiomatosis, most often involving the occipital and posterior parietal lobes. The most common features are facial cutaneous vascular malformations (port-wine stains), seizures, and glaucoma. Stasis results in ischemia underlying the leptomeningeal angiomatosis, leading to calcification and laminar cortical necrosis. The clinical course is highly variable and some children experience intractable seizures, mental retardation, and recurrent stroke-like episodes.
PTM
Palmitoylated by ZDHHC3 and ZDHHC7 (PubMed:19001095). Palmitoylation occurs in the Golgi and participates in the localization of GNAQ to the plasma membrane (PubMed:19001095).
(Microbial infection) Deamidated at Gln-209 by Photorhabdus asymbiotica toxin PAU_02230, blocking GTP hydrolysis of heterotrimeric GNAQ or GNA11 and G-alphai (GNAI1, GNAI2 or GNAI3) proteins, thereby activating RhoA.
Histaminylated at Gln-209 residues by TGM2.

Galeffi, F., Snellings, D. A., Wetzel-Strong, S. E., Kastelic, N., Bullock, J., Gallione, C. J., ... & Marchuk, D. A. (2022). A novel somatic mutation in GNAQ in a capillary malformation provides insight into molecular pathogenesis. Angiogenesis, 25(4), 493-502.

Zhu, M., Zhang, H., Yang, H., Zhao, Z., Blair, H. T., Liang, H., ... & Yu, Q. (2022). Targeting GNAQ in hypothalamic nerve cells to regulate seasonal estrus in sheep. Theriogenology, 181, 79-88.

Hou, C., Xiao, L., Ren, X., Tang, F., Guo, B., Zeng, W., ... & Yan, N. (2020). Mutations of GNAQ, GNA11, SF3B1, EIF1AX, PLCB4 and CYSLTR in Uveal melanoma in Chinese patients. Ophthalmic research, 63(3), 358-368.

Choi, J. Y., Lee, Y. S., Shim, D. M., & Seo, S. W. (2020). Effect of GNAQ alteration on RANKL-induced osteoclastogenesis in human non-small-cell lung cancer. Bone & Joint Research, 9(1), 29-35.

Eichenfield, D. Z., Cotter, D., Thorson, J., Hinds, B., & Sun, B. K. (2019). Agminated blue nevus with a GNAQ mutation: A case report and review of the literature. Journal of Cutaneous Pathology, 46(2), 130-133.

Li, Y., He, J., Qiu, C., Shang, Q., Qian, G., Fan, X., ... & Jia, R. (2019). The oncolytic virus H101 combined with GNAQ siRNA‐mediated knockdown reduces uveal melanoma cell viability. Journal of cellular biochemistry, 120(4), 5766-5776.

Parish, A. J., Nguyen, V., Goodman, A. M., Murugesan, K., Frampton, G. M., & Kurzrock, R. (2018). GNAS, GNAQ, and GNA11 alterations in patients with diverse cancers. Cancer, 124(20), 4080-4089.

Ask a question We look forward to hearing from you.
0 reviews or Q&As
Loading...
Have you used Mouse Anti-GNAQ Recombinant Antibody (13H4)?
Submit a review and get a Coupon or an Amazon gift card. 20% off Coupon $30 eGift Card
Submit a review
Loading...
For research use only. Not intended for any clinical use.

Custom Antibody Labeling

We also offer labeled antibodies developed using our catalog antibody products and nonfluorescent conjugates (HRP, AP, Biotin, etc.) or fluorescent conjugates (Alexa Fluor, FITC, TRITC, Rhodamine, Texas Red, R-PE, APC, Qdot Probes, Pacific Dyes, etc.).

Online Inquiry

Documents

Contact us

  • Tel: (USA)
  • (UK)
  • Fax:
  • Email:

Submit A Review

Go to
Compare