Sign in or Register   Sign in or Register
  |  

Mouse Anti-LAMA1 Recombinant Antibody (CBYJL-1078) (CBMAB-L0520-YJ)

Provided herein is a Mouse monoclonal antibody, which binds to Laminin Subunit Alpha 1 (LAMA1). The antibody can be used for immunoassay techniques, such as WB, IHC-P.
See all LAMA1 antibodies

Summary

Host Animal
Mouse
Specificity
Human
Clone
CBYJL-1078
Antibody Isotype
IgG1
Application
WB, IHC-P

Basic Information

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LIVQGRGLIDAAAAQTDAVQDALEHLEDHQDKLLLWSAKIRHHIDDLVMHMSQRNAVDLVYRAEDHATEFQRLADVLYSGLENIRNVSLNATSAA.
Specificity
Human
Antibody Isotype
IgG1
Clonality
Monoclonal
Application Notes
The COA includes recommended starting dilutions, optimal dilutions should be determined by the end user.

Formulations & Storage [For reference only, actual COA shall prevail!]

Buffer
PBS, pH 7.4
Storage
Store at 4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze/thaw cycles.

Target

Full Name
laminin, alpha 1
Introduction
LAMA1 is one of the alpha 1 subunits of laminin. The laminins are a family of extracellular matrix glycoproteins that have a heterotrimeric structure composed of an alpha, beta and gamma chain. These proteins make up a major component of the basement membrane and have been implicated in a wide variety of biological processes including cell adhesion, differentiation, migration, signaling, neurite outgrowth and metastasis. Mutations in this gene may be associated with Poretti-Boltshauser syndrome. Among its related pathways are ERK Signaling and Focal Adhesion.
Entrez Gene ID
UniProt ID
Alternative Names
LAMA; PTBHS; S-LAM-alpha
Function
Binding to cells via a high affinity receptor, laminin is thought to mediate the attachment, migration and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components.
Biological Process
Animal organ morphogenesisManual Assertion Based On ExperimentIBA:GO_Central
Axon guidanceManual Assertion Based On ExperimentIBA:GO_Central
Blood vessel morphogenesisManual Assertion Based On ExperimentIBA:GO_Central
Branching involved in salivary gland morphogenesisIEA:Ensembl
Camera-type eye developmentManual Assertion Based On ExperimentIBA:GO_Central
Cell adhesionIEA:UniProtKB-KW
Cell surface receptor signaling pathwayISS:UniProtKB
Epithelial tube branching involved in lung morphogenesisIEA:Ensembl
Establishment of epithelial cell apical/basal polarityIEA:Ensembl
Morphogenesis of an epithelial sheetIEA:Ensembl
Protein phosphorylationIEA:Ensembl
Regulation of cell adhesionIEA:InterPro
Regulation of cell migrationIEA:InterPro
Regulation of embryonic developmentIEA:InterPro
Retinal blood vessel morphogenesisIEA:Ensembl
Tissue developmentManual Assertion Based On ExperimentIBA:GO_Central
Cellular Location
Secreted, extracellular space, extracellular matrix, basement membrane
Major component.
Involvement in disease
Poretti-Boltshauser syndrome (PTBHS):
An autosomal recessive disorder characterized by cerebellar dysplasia, cerebellar vermis atrophy, cerebellar cysts in most patients, high myopia, variable retinal dystrophy, and eye movement abnormalities including strabismus, ocular apraxia, nystagmus. Affected individuals have ataxia, delayed motor development, language impairment, and intellectual disability with variable severity.
PTM
Tyrosine phosphorylated by PKDCC/VLK.

Wang, P., Jia, X., Xiao, X., Li, S., Long, Y., Liu, M., ... & Zhang, Q. (2021). An early diagnostic clue for COL18A1-and LAMA1-associated diseases: high myopia with alopecia areata in the cranial midline. Frontiers in Cell and Developmental Biology, 9, 644947.

Powell, L., Olinger, E., Wedderburn, S., Ramakumaran, V. S., Kini, U., Clayton-Smith, J., ... & Sayer, J. A. (2021). Identification of LAMA1 mutations ends diagnostic odyssey and has prognostic implications for patients with presumed Joubert syndrome. Brain Communications, 3(3), fcab163.

Zhou, P. L., Wu, Z., Zhang, W., Xu, M., Ren, J., Zhang, Q., ... & Han, X. (2021). Circular RNA hsa_circ_0000277 sequesters miR-4766-5p to upregulate LAMA1 and promote esophageal carcinoma progression. Cell death & disease, 12(7), 676.

Kurek, M., Åkesson, E., Yoshihara, M., Oliver, E., Cui, Y., Becker, M., ... & Stukenborg, J. B. (2021). Spermatogonia loss correlates with LAMA 1 expression in human prepubertal testes stored for fertility preservation. Cells, 10(2), 241.

Chen, M., Zhang, M., Qian, Y., Yang, Y., Sun, Y., Liu, B., ... & Dong, M. (2020). Identification of a likely pathogenic structural variation in the LAMA1 gene by Bionano optical mapping. NPJ genomic medicine, 5(1), 31.

Elmas, M., Gogus, B., & Solak, M. (2020). Understanding what you have found: a family with a mutation in the LAMA1 gene with literature review. Clinical Medicine Insights: Case Reports, 13, 1179547620948666.

Biler, E. D., Ilim, O., Palamar, M., Onay, H., & Uretmen, O. (2018). TGFB1 and LAMA1 gene polymorphisms in children with high myopia. Pakistan journal of medical sciences, 34(2), 463.

Marlow, E., Chan, R. P., Oltra, E., Rusu, I., & Gupta, M. P. (2018). Retinal avascularity and neovascularization associated with LAMA1 (laminin1) mutation in Poretti-Boltshauser syndrome. JAMA ophthalmology, 136(1), 96-97.

Kashevarova, A. A., Nazarenko, L. P., Skryabin, N. A., Nikitina, T. V., Vasilyev, S. A., Tolmacheva, E. N., ... & Lebedev, I. N. (2018). A mosaic intragenic microduplication of LAMA1 and a constitutional 18p11. 32 microduplication in a patient with keratosis pilaris and intellectual disability. American Journal of Medical Genetics Part A, 176(11), 2395-2403.

Ask a question We look forward to hearing from you.
0 reviews or Q&As
Loading...
Have you used Mouse Anti-LAMA1 Recombinant Antibody (CBYJL-1078)?
Submit a review and get a Coupon or an Amazon gift card. 20% off Coupon $30 eGift Card
Submit a review
Loading...
For research use only. Not intended for any clinical use.

Custom Antibody Labeling

We also offer labeled antibodies developed using our catalog antibody products and nonfluorescent conjugates (HRP, AP, Biotin, etc.) or fluorescent conjugates (Alexa Fluor, FITC, TRITC, Rhodamine, Texas Red, R-PE, APC, Qdot Probes, Pacific Dyes, etc.).

Online Inquiry

Documents

Contact us

  • Tel: (USA)
  • (UK)
  • Fax:
  • Email:

Submit A Review

Go to
Compare