Sign in or Register   Sign in or Register
  |  

Mouse Anti-RBBP4 Recombinant Antibody (9F3) (CBMAB-BR427LY)

The product is antibody recognizes RBBP4. The antibody 9F3 immunoassay techniques such as: IHC, WB.
See all RBBP4 antibodies

Summary

Host Animal
Mouse
Specificity
Human, Mouse, Rat
Clone
9F3
Antibody Isotype
IgG1
Application
IHC: 1:300-1:500 dilution, WB: 0.1-0.5 μg/ml

Basic Information

Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human RbAp48 (395-425aa EDNIMQVWQMAENIYNDEDPEGSVDPEGQGS), identical to the related mouse sequence.
Specificity
Human, Mouse, Rat
Antibody Isotype
IgG1
Clonality
Monoclonal
Application Notes
The COA includes recommended starting dilutions, optimal dilutions should be determined by the end user.

Formulations & Storage [For reference only, actual COA shall prevail!]

Format
Lyophilized
Preservative
0.05 mg sodium azide
Storage
Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freezethaw cycles.

Target

Full Name
RB Binding Protein 4, Chromatin Remodeling Factor
Introduction
This gene encodes a ubiquitously expressed nuclear protein which belongs to a highly conserved subfamily of WD-repeat proteins. It is present in protein complexes involved in histone acetylation and chromatin assembly. It is part of the Mi-2 complex which has been implicated in chromatin remodeling and transcriptional repression associated with histone deacetylation. This encoded protein is also part of co-repressor complexes, which is an integral component of transcriptional silencing. It is found among several cellular proteins that bind directly to retinoblastoma protein to regulate cell proliferation. This protein also seems to be involved in transcriptional repression of E2F-responsive genes. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2008]
Entrez Gene ID
Human5928
Mouse19646
Rat313048
UniProt ID
HumanQ09028
MouseQ60972
RatB5DFB2
Alternative Names
Histone-binding protein RBBP4; Chromatin assembly factor 1 subunit C; CAF-1 subunit C; Chromatin assembly factor I p48 subunit; CAF-I 48 kDa subunit; CAF-I p48; Nucleosome-remodeling factor subunit RBAP48; Retinoblastoma-binding protein 4; RBBP-4; Retinoblastoma-binding protein p48; RBBP4; RBAP48
Function
Core histone-binding subunit that may target chromatin assembly factors, chromatin remodeling factors and histone deacetylases to their histone substrates in a manner that is regulated by nucleosomal DNA. Component of several complexes which regulate chromatin metabolism. These include the chromatin assembly factor 1 (CAF-1) complex, which is required for chromatin assembly following DNA replication and DNA repair; the core histone deacetylase (HDAC) complex, which promotes histone deacetylation and consequent transcriptional repression; the nucleosome remodeling and histone deacetylase complex (the NuRD complex), which promotes transcriptional repression by histone deacetylation and nucleosome remodeling; the PRC2 complex, which promotes repression of homeotic genes during development; and the NURF (nucleosome remodeling factor) complex.
Biological Process
Biological Process brain development1 PublicationIC:ComplexPortal
Biological Process cell cycleIEA:UniProtKB-KW
Biological Process chromatin assemblyManual Assertion Based On ExperimentIDA:UniProtKB
Biological Process chromatin remodelingManual Assertion Based On ExperimentIDA:HGNC-UCL
Biological Process DNA replicationIEA:UniProtKB-KW
Biological Process DNA replication-dependent chromatin assemblyManual Assertion Based On ExperimentIDA:UniProtKB
Biological Process DNA replication-independent chromatin assemblyManual Assertion Based On ExperimentIDA:UniProtKB
Biological Process histone deacetylationManual Assertion Based On ExperimentIDA:ComplexPortal
Biological Process negative regulation of cell migration1 PublicationIC:ComplexPortal
Biological Process negative regulation of cell population proliferationManual Assertion Based On ExperimentTAS:ProtInc
Biological Process negative regulation of stem cell population maintenance1 PublicationIC:ComplexPortal
Biological Process negative regulation of transcription by RNA polymerase II2 PublicationsIC:ComplexPortal
Biological Process negative regulation of transcription, DNA-templated1 PublicationIC:ComplexPortal
Biological Process negative regulation of transforming growth factor beta receptor signaling pathway1 PublicationIC:ComplexPortal
Biological Process positive regulation of stem cell population maintenance1 PublicationIC:ComplexPortal
Biological Process positive regulation of transcription, DNA-templated1 PublicationIC:ComplexPortal
Biological Process regulation of cell fate specification1 PublicationIC:ComplexPortal
Biological Process regulation of stem cell differentiation1 PublicationIC:ComplexPortal
Biological Process regulation of transcription, DNA-templatedManual Assertion Based On ExperimentIDA:ComplexPortal
Cellular Location
Nucleus
Chromosome, telomere
Localizes to chromatin as part of the PRC2 complex.
Ask a question We look forward to hearing from you.
0 reviews or Q&As

Purchasing FAQs
Technical FAQs

Loading...
Have you used Mouse Anti-RBBP4 Recombinant Antibody (9F3)?
Submit a review and get a Coupon or an Amazon gift card. 20% off Coupon $30 eGift Card
Submit a review
Loading...
For research use only. Not intended for any clinical use.

Custom Antibody Labeling

We also offer labeled antibodies developed using our catalog antibody products and nonfluorescent conjugates (HRP, AP, Biotin, etc.) or fluorescent conjugates (Alexa Fluor, FITC, TRITC, Rhodamine, Texas Red, R-PE, APC, Qdot Probes, Pacific Dyes, etc.).

Online Inquiry

Documents

Contact us

  • Tel: (USA)
  • (UK)
  • Fax:
  • Email:

Submit A Review

Go to
Compare