Mouse Anti-TFPI2 Recombinant Antibody (CBYJT-2721) (CBMAB-T1910-YJ)

Basic Information
Sequence:
DAAQEPTGNNAEICLLPLDYGPCRALLLRYYYDRYTQSCRQFLYGGCEGN ANNFYTWEACDDACWRIEKVPKVCRLQVSVDDQCEGSTEKYFFNLSSMTC EKFFSGGCHRNRIENRFPDEATCMGFCAPKKIPSFCYSPKDEGLCSANVT RYYFNPRYRTCDAFTYTGCGGNDNNFVSREDCKRACAKALKKKKKMPKLR FASRIRKIRKKQ
Formulations & Storage [For reference only, actual COA shall prevail!]
Target
Biological Process cellular response to fluid shear stressSource:Ensembl
Submit a review and get a Coupon or an Amazon gift card. 20% off Coupon

Submit a review

Please try the standard protocols which include: protocols, troubleshooting and guide.
Enzyme-linked Immunosorbent Assay (ELISA)
Flow Cytometry
Immunofluorescence (IF)
Immunohistochemistry (IHC)
Immunoprecipitation (IP)
Western Blot (WB)
Enzyme Linked Immunospot (ELISpot)
Proteogenomic
Other Protocols
Related Products
Rat Anti-Tfpi2 Recombinant Antibody (CBYJT-2730) (CAT#: CBMAB-T1919-YJ)
Rat Anti-Tfpi2 Recombinant Antibody (CBYJT-2728) (CAT#: CBMAB-T1917-YJ)
Rabbit Anti-Tfpi2 Recombinant Antibody (CBYJT-2727) (CAT#: CBMAB-T1916-YJ)
Mouse Anti-TFPI2 Recombinant Antibody (CBYJT-2718) (CAT#: CBMAB-T1907-YJ)
Mouse Anti-TFPI2 Recombinant Antibody (CBYJT-2723) (CAT#: CBMAB-T1912-YJ)
Mouse Anti-TFPI2 Recombinant Antibody (CBYJT-2722) (CAT#: CBMAB-T1911-YJ)
Mouse Anti-TFPI2 Recombinant Antibody (CBXF-0080) (CAT#: CBMAB-F1316-CQ)
Mouse Anti-TFPI2 Recombinant Antibody (CBYJT-2717) (CAT#: CBMAB-T1906-YJ)
Mouse Anti-TFPI2 Recombinant Antibody (CBYJT-2719) (CAT#: CBMAB-T1908-YJ)
Custom Antibody Labeling
We also offer labeled antibodies developed using our catalog antibody products and nonfluorescent conjugates (HRP, AP, Biotin, etc.) or fluorescent conjugates (Alexa Fluor, FITC, TRITC, Rhodamine, Texas Red, R-PE, APC, Qdot Probes, Pacific Dyes, etc.).
Online InquiryContact us
