Sign in or Register   Sign in or Register
  |  

Mouse Anti-ABCC1 Recombinant Antibody (V2-178989) (CBMAB-A0224-YC)

Provided herein is a Mouse monoclonal antibody against Human ATP Binding Cassette Subfamily C Member 1. The antibody can be used for immunoassay techniques, such as WB, IF.
See all ABCC1 antibodies
Published Data

Summary

Host Animal
Mouse
Specificity
Human, Mouse
Clone
V2-178989
Antibody Isotype
IgG1
Application
WB, IF

Basic Information

Immunogen
A recombinant peptide corresponding to residues 1-33 (N-terminal: SMALRGFCSADGSDPLWDWNVTWNTSNPDFTKCF) of the human protein.
Specificity
Human, Mouse
Antibody Isotype
IgG1
Clonality
Monoclonal
Application Notes
The COA includes recommended starting dilutions, optimal dilutions should be determined by the end user.
ApplicationNote
WB1:250-1:500
IHC-P1:200
IHC1:200
IF(ICC)1:10-1:2,000

Formulations & Storage [For reference only, actual COA shall prevail!]

Format
0.1% sodium azide
Buffer
PBS
Preservative
0.02% sodium azide
Concentration
1 mg/ml
Storage
Store at 4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze/thaw cycles.

Target

Full Name
ATP-binding cassette, sub-family C (CFTR/MRP), member 1
Introduction
ABCC1 is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra-and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN2
Entrez Gene ID
Human4363
Mouse17250
UniProt ID
HumanP33527
MouseO35379
Alternative Names
ATP Binding Cassette Subfamily C Member 1; ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 1; Leukotriene C(4) Transporter; LTC4 Transporter; MRP1; MRP; ATP-Binding Cassette Transporter Variant ABCC1delta-Ex13&14; ATP-Binding Cassette Transporter Va
Function
Mediates export of organic anions and drugs from the cytoplasm. Mediates ATP-dependent transport of glutathione and glutathione conjugates, leukotriene C4, estradiol-17-beta-o-glucuronide, methotrexate, antiviral drugs and other xenobiotics. Confers resistance to anticancer drugs by decreasing accumulation of drug in cells, and by mediating ATP- and GSH-dependent drug export. Hydrolyzes ATP with low efficiency. Catalyzes the export of sphingosine 1-phosphate from mast cells independently of their degranulation. Participates in inflammatory response by allowing export of leukotriene C4 from leukotriene C4-synthezing cells (By similarity).
Biological Process
Carboxylic acid transmembrane transport
Cell chemotaxis
Cellular response to amyloid-beta
Cobalamin metabolic process
Cobalamin transport
Export across plasma membrane
Glutathione transmembrane transport
Heme catabolic process
Leukotriene metabolic process
Leukotriene transport
Phospholipid translocation
Positive regulation of inflammatory response
Response to drug
Sphingolipid translocation
Transepithelial transport
Transmembrane transport
Transport across blood-brain barrier
Xenobiotic transport
Xenobiotic transport across blood-brain barrier
Cellular Location
Cell membrane
Involvement in disease
A form of non-syndromic deafness characterized by adult onset of bilateral, postlingual, mild-to-severe sensorineural hearing loss. Sensorineural hearing loss results from damage to the neural receptors of the inner ear, the nerve pathways to the brain, or the area of the brain that receives sound information.
Topology
Extracellular: 1-33 aa
Helical: 34-54 aa
Cytoplasmic: 55-74 aa
Helical: 75-95 aa
Extracellular: 96-100 aa
Helical: 101-121 aa
Cytoplasmic: 122-133 aa
Helical: 134-154 aa
Extracellular: 155-172 aa
Helical: 173-193 aa
Cytoplasmic: 194-316 aa
Helical: 317-337 aa
Extracellular: 338-363 aa
Helical: 364-384 aa
Cytoplasmic: 385-440 aa
Helical: 441-461 aa
Extracellular: 462-464 aa
Helical: 465-485 aa
Cytoplasmic: 486-547 aa
Helical: 548-568 aa
Extracellular: 569-590 aa
Helical: 591-611 aa
Cytoplasmic: 612-967 aa
Helical: 968-988 aa
Extracellular: 989-1025 aa
Helical: 1026-1046 aa
Cytoplasmic: 1047-1089 aa
Helical: 1090-1110 aa
Extracellular: 1111 aa
Helical: 1112-1132 aa
Cytoplasmic: 1133-1203 aa
Helical: 1204-1224 aa
Extracellular: 1225-1226 aa
Helical: 1227-1247 aa
Cytoplasmic: 1248-1531 aa

Jepsen, W. (2021). Adenosine Triphosphate Binding Cassette Subfamily C Member 1 (ABCC1) Modulates Amyloid Precursor Protein (App) Processing: a Potential Therapeutic Target for the Treatment of Alzheimer’s Disease (Doctoral dissertation, Arizona State University).

Chen, X. Y., Yang, Y., Wang, J. Q., Wu, Z. X., Li, J., & Chen, Z. S. (2021). Overexpression of ABCC1 confers drug resistance to betulin. Frontiers in oncology, 11.

Gallman, A. E., Wolfreys, F. D., Nguyen, D. N., Sandy, M., Xu, Y., An, J., ... & Cyster, J. G. (2021). Abcc1 and Ggt5 support lymphocyte guidance through export and catabolism of S-geranylgeranyl-L-glutathione. Science Immunology, 6(60).

Zhang, L., Huang, P., Huang, C., Jiang, L., Lu, Z., & Wang, P. (2021). Varied clinical significance of ATP-binding cassette C sub-family members for lung adenocarcinoma. Medicine, 100(16).

Huang, W., Huang, F., & Feng, C. (2020). CircFoxo3 promotes adriamycin resistance through regulation of miR-199a-5p/ATP binding cassette subfamily C member 1 Axis in hepatocellular carcinoma. OncoTargets and therapy, 13, 5113.

Low, F. (2019). ATP-binding cassette subfamily C (ABCC) transporter 1 (ABCC1) and 4 (ABCC4) independent of their drug efflux ability affects breast cancer biology (Doctoral dissertation, Aston University).

Jang, H., Choi, Y., Yoo, I., Han, J., Kim, M., & Ka, H. (2017). Expression and regulation of prostaglandin transporters, ATP-binding cassette, subfamily C, member 1 and 9, and solute carrier organic anion transporter family, member 2A1 and 5A1 in the uterine endometrium during the estrous cycle and pregnancy in pigs. Asian-Australasian journal of animal sciences, 30(5), 643.

Ask a question We look forward to hearing from you.
0 reviews or Q&As
Loading...
Have you used Mouse Anti-ABCC1 Recombinant Antibody (V2-178989)?
Submit a review and get a Coupon or an Amazon gift card. 20% off Coupon $30 eGift Card
Submit a review
Loading...
For research use only. Not intended for any clinical use.

Custom Antibody Labeling

We also offer labeled antibodies developed using our catalog antibody products and nonfluorescent conjugates (HRP, AP, Biotin, etc.) or fluorescent conjugates (Alexa Fluor, FITC, TRITC, Rhodamine, Texas Red, R-PE, APC, Qdot Probes, Pacific Dyes, etc.).

Online Inquiry

Documents

Contact us

  • Tel: (USA)
  • (UK)
  • Fax:
  • Email:

Submit A Review

Go to
Compare