Mouse Anti-CDKL2 Recombinant Antibody (CBFYC-1624) (CBMAB-C1684-FY)

Go to compare Compare Online Inquiry
Request for COA
Datasheet Target References Q & As Review & reward Protocols Associated Products

Basic Information

Host Animal
Mouse
Clone
CBFYC-1624
Application
WB, IHC, ELISA, IF
Immunogen
LKDCSNVSVDHTRNPSVAIPPLTHNLSAVAPSINSGMGTE TIPIQGYRVDEKTKKCSIPFVKPNRHSPSGIYNINVTTLV SGPPLSDDSGADLPQMEHQH
Host Species
Mouse
Specificity
Human
Antibody Isotype
IgG1, κ
Clonality
Monoclonal Antibody
Application Notes
The COA includes recommended starting dilutions, optimal dilutions should be determined by the end user.

Formulations & Storage [For reference only, actual COA shall prevail!]

Format
Liquid
Concentration
Batch dependent
Storage
Store at +4°C short term (1-2 weeks). Aliquot and store at-20°C long term. Avoid repeated freeze/thaw cycles.
Epitope
AA 291-493
More Infomation

Target

Full Name
Cyclin Dependent Kinase Like 2
Introduction
CDKL2 (Cyclin Dependent Kinase Like 2) is a Protein Coding gene. Diseases associated with CDKL2 include Joubert Syndrome 1. Gene Ontology (GO) annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is CDKL3.
Entrez Gene ID
UniProt ID
Alternative Names
Cyclin Dependent Kinase Like 2; Protein Kinase P56 KKIAMRE; EC 2.7.11.22; Cyclin-Dependent Kinase-Like 2 (CDC2-Related Kinase); Serine/Threonine Protein Kinase KKIAMRE; Serine/Threonine-Protein Kinase KKIAMRE; Testicular Tissue Protein Li 35
Biological Process
Protein phosphorylation Source: GO_Central
Sex differentiation Source: ProtInc
Signal transduction Source: ProtInc
Cellular Location
Nucleus; Cytoplasm

Yi, R., Yang, S., Liao, Y., Hu, Z., Long, H., Zeng, Y., ... & Wu, Z. (2020). Decreased CDKL2 expression is correlated with the progression and poor prognosis of glioma. Pathology-Research and Practice, 216(5), 152920.

Shao, Q., Wang, F., Xu, Y., Zhang, X., Tang, W., Feng, Y., & Li, Y. (2020). CDKL2 Is Associated with HER2 Status and Overall Survival in Gastric Cancer: Comparative Analysis of CDKL2 Protein Expression and Gene Copy Number. BioMed Research International, 2020.

Zhou, Y., Qiu, X. P., Li, Z. H., Zhang, S., Rong, Y., & Yang, G. H. (2019). Clinical significance of aberrant cyclin-dependent kinase-like 2 methylation in hepatocellular carcinoma. Gene, 683, 35-40.

Zhao, Y., Yang, J., Liu, Y., Fan, J., & Yang, H. (2019). HSV-2-encoded miRNA-H4 regulates cell cycle progression and Act-D-induced apoptosis in HeLa Cells by targeting CDKL2 and CDKN2A. Virologica Sinica, 34(3), 278-286.

Fang, C. L., Uen, Y. H., Chen, H. K., Hseu, Y. C., Lin, C. C., Hung, S. T., ... & Lin, K. Y. (2018). Loss of cyclin‐dependent kinase‐like 2 predicts poor prognosis in gastric cancer, and its overexpression suppresses cells growth and invasion. Cancer medicine, 7(7), 2993-3002.

Yi, R., Yang, S., Wen, E., Hu, Z., Long, H., Zeng, Y., ... & Song, Y. (2018). Negative nuclear expression of CDKL2 correlates with disease progression and poor prognosis of glioma. International journal of clinical and experimental pathology, 11(2), 712.

Lin, K. Y., & Uen, Y. H. (2017). Loss of CDKL2 expression correlates with differentiation, stage, and poor prognosis of gastric cancer. Annals of Oncology, 28, x12.

Ask a question We look forward to hearing from you.
0 reviews or Q&As
Loading...
Have you used Mouse Anti-CDKL2 Recombinant Antibody (CBFYC-1624)?
Submit a review and get a Coupon or an Amazon gift card. 20% off Coupon $30 eGift Card
Submit a review
Loading...
For research use only. Not intended for any clinical use.

Custom Antibody Labeling

We also offer labeled antibodies developed using our catalog antibody products and nonfluorescent conjugates (HRP, AP, Biotin, etc.) or fluorescent conjugates (Alexa Fluor, FITC, TRITC, Rhodamine, Texas Red, R-PE, APC, Qdot Probes, Pacific Dyes, etc.).

Online Inquiry

Contact us

  • Tel: (USA)
  • (UK)
  • Fax:
  • Email:

Submit A Review

online inquiry
Online Inquiry