Sign in or Register   Sign in or Register
  |  

Mouse Anti-CFL2 Recombinant Antibody (8C13) (CBMAB-BR133LY)

The product is antibody recognizes CFL2. The antibody 8C13 immunoassay techniques such as: FC, IF, IHC-P, ICC, WB.
See all CFL2 antibodies

Summary

Host Animal
Mouse
Specificity
Human, Mouse, Rat
Clone
8C13
Antibody Isotype
IgG2b
Application
FC: 1-3 μg/1x10 cells, IF: 1:1000 dilution, IHC-P: 0.5-1 μg/ml, ICC: 1:200 dilution, WB: 0.1-0.5 μg/ml

Basic Information

Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human Cofilin 2/CFL2 (121-153aa KDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKL), identical to the related mouse sequence.
Specificity
Human, Mouse, Rat
Antibody Isotype
IgG2b
Clonality
Monoclonal
Application Notes
The COA includes recommended starting dilutions, optimal dilutions should be determined by the end user.

Formulations & Storage [For reference only, actual COA shall prevail!]

Format
Lyophilized
Preservative
0.05 mg sodium azide
Storage
Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freezethaw cycles.

Target

Full Name
cofilin 2
Entrez Gene ID
Human1073
Mouse12632
Rat366624
UniProt ID
HumanQ9Y281
MouseP45591
RatM0RC65
Alternative Names
Cofilin-2; Cofilin, muscle isoform; CFL2
Function
Controls reversibly actin polymerization and depolymerization in a pH-sensitive manner. Its F-actin depolymerization activity is regulated by association with CSPR3 (PubMed:19752190).
It has the ability to bind G- and F-actin in a 1:1 ratio of cofilin to actin. It is the major component of intranuclear and cytoplasmic actin rods. Required for muscle maintenance. May play a role during the exchange of alpha-actin forms during the early postnatal remodeling of the sarcomere (By similarity).
Biological Process
Actin filament depolymerization Source: UniProtKB
Actin filament fragmentation Source: GO_Central
Actin filament severing Source: GO_Central
Cell motility Source: GO_Central
Muscle cell cellular homeostasis Source: Ensembl
Positive regulation of actin filament depolymerization Source: UniProtKB
Sarcomere organization Source: Ensembl
Skeletal muscle tissue development Source: Ensembl
Cellular Location
Cytoskeleton; Nucleus matrix. Colocalizes with CSPR3 in the Z line of sarcomeres.
Involvement in disease
Nemaline myopathy 7 (NEM7): A form of nemaline myopathy. Nemaline myopathies are muscular disorders characterized by muscle weakness of varying severity and onset, and abnormal thread-like or rod-shaped structures in muscle fibers on histologic examination. Nemaline myopathy type 7 presents at birth with hypotonia and generalized weakness. Major motor milestones are delayed, but independent ambulation is achieved.
PTM
The phosphorylation of Ser-24 may prevent recognition of the nuclear localization signal.

Zhu, Z., Duan, P., Song, H., Zhou, R., & Chen, T. (2021). Downregulation of Circular RNA PSEN1 ameliorates ferroptosis of the high glucose treated retinal pigment epithelial cells via miR-200b-3p/cofilin-2 axis. Bioengineered, 12(2), 12555-12567.

Mamoor, S. (2021). Differential expression of cofilin 2 in cancers of the breast.

Pignataro, M., Di Rocco, G., Lancellotti, L., Bernini, F., Subramanian, K., Castellini, E., ... & Del Monte, F. (2020). Phosphorylated cofilin-2 is more prone to oxidative modifications on Cys39 and favors amyloid fibril formation. Redox biology, 37, 101691.

Wo, Q., Zhang, D., Hu, L., Lyu, J., Xiang, F., Zheng, W., ... & Qi, X. (2019). Long noncoding RNA SOX2-OT facilitates prostate cancer cell proliferation and migration via miR-369-3p/CFL2 axis. Biochemical and biophysical research communications, 520(3), 586-593.

Mohri, K., Suzuki-Toyota, F., Obinata, T., & Sato, N. (2019). Chimeric Mice with Deletion of Cfl2 that Encodes Muscle-Type Cofilin (MCF or Cofilin-2) Results in Defects of Striated Muscles, Both Skeletal and Cardiac Muscles. Zoological science, 36(2), 112-119.

Zhu, H., Yang, H., Zhao, S., Zhang, J., Liu, D., Tian, Y., ... & Su, Y. (2018). Role of the cofilin 2 gene in regulating the myosin heavy chain genes in mouse myoblast C2C12 cells. International journal of molecular medicine, 41(2), 1096-1102.

Yu, B. B., Lin, G. X., Li, L., Qu, S., Liang, Z. G., Chen, K. H., ... & Zhu, X. D. (2018). Cofilin-2 acts as a marker for predicting radiotherapy response and is a potential therapeutic target in nasopharyngeal carcinoma. Medical science monitor: international medical journal of experimental and clinical research, 24, 2317.

Yehl, J., Kudryashova, E., Reisler, E., Kudryashov, D., & Polenova, T. (2017). Structural analysis of human cofilin 2/filamentous actin assemblies: atomic-resolution insights from magic angle spinning NMR spectroscopy. Scientific reports, 7(1), 1-10.

Rangrez, A. Y., Hoppe, P., Kuhn, C., Zille, E., Frank, J., Frey, N., & Frank, D. (2017). MicroRNA miR-301a is a novel cardiac regulator of Cofilin-2. PloS one, 12(9), e0183901.

Ask a question We look forward to hearing from you.
0 reviews or Q&As

Purchasing FAQs
Technical FAQs

Loading...
Have you used Mouse Anti-CFL2 Recombinant Antibody (8C13)?
Submit a review and get a Coupon or an Amazon gift card. 20% off Coupon $30 eGift Card
Submit a review
Loading...
For research use only. Not intended for any clinical use.

Custom Antibody Labeling

We also offer labeled antibodies developed using our catalog antibody products and nonfluorescent conjugates (HRP, AP, Biotin, etc.) or fluorescent conjugates (Alexa Fluor, FITC, TRITC, Rhodamine, Texas Red, R-PE, APC, Qdot Probes, Pacific Dyes, etc.).

Online Inquiry

Documents

Contact us

  • Tel: (USA)
  • (UK)
  • Fax:
  • Email:

Submit A Review

Go to
Compare