Search :
Sign in or Register  
Welcome Sign in or Don't have an account?Register

Mouse Anti-FBLN1 Recombinant Antibody (CL0337) (CBMAB-F2772-CQ)

Online Inquiry

Summary

Host Animal
Mouse
Specificity
Human
Clone
CL0337
Antibody Isotype
IgG1
Application
WB, IHC, IF, IHC-P

Basic Information

Immunogen
Recombinant protein corresponding to amino acids: CESGIHNCLPDFICQNTLGSFRCRPKLQCKSGFIQDALGNCIDINECLSISAPCPIGHTCINTEGSYTCQKNVPNCGRGYHLNEEGTRCVDVDECAPPAEPCGKGHRCVNSPGSFRCECKTGYYFDGISRMCVDVNE
Specificity
Human
Antibody Isotype
IgG1
Clonality
Monoclonal
Application Notes
The COA includes recommended starting dilutions, optimal dilutions should be determined by the end user.

Formulations & Storage [For reference only, actual COA shall prevail!]

Storage
Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze/thaw cycles.

Target

Full Name
Fibulin 1
Introduction
Fibulin 1 is a secreted glycoprotein that becomes incorporated into a fibrillar extracellular matrix. Calcium-binding is apparently required to mediate its binding to laminin and nidogen. It mediates platelet adhesion via binding fibrinogen. Four splice variants which differ in the 3' end have been identified. Each variant encodes a different isoform, but no functional distinctions have been identified among the four variants.
Entrez Gene ID
UniProt ID
Alternative Names
Fibulin 1; Fibulin-1; FIBL-1; FIBL1; FBLN;
Research Area
Incorporated into fibronectin-containing matrix fibers. May play a role in cell adhesion and migration along protein fibers within the extracellular matrix (ECM). Could be important for certain developmental processes and contribute to the supramolecular organization of ECM architecture, in particular to those of basement membranes. Has been implicated in a role in cellular transformation and tumor invasion, it appears to be a tumor suppressor. May play a role in haemostasis and thrombosis owing to its ability to bind fibrinogen and incorporate into clots. Could play a significant role in modulating the neurotrophic activities of APP, particularly soluble APP.
Biological Process
Blood coagulation, fibrin clot formation Source: UniProtKB
Embryo implantation Source: Ensembl
Extracellular matrix organization Source: Ensembl
Negative regulation of cell adhesion Source: UniProtKB
Negative regulation of cell motility Source: UniProtKB
Negative regulation of ERK1 and ERK2 cascade Source: UniProtKB
Negative regulation of protein phosphorylation Source: UniProtKB
Negative regulation of stem cell proliferation Source: UniProtKB
Negative regulation of substrate adhesion-dependent cell spreading Source: UniProtKB
Negative regulation of transformation of host cell by virus Source: UniProtKB
Negative regulation of transforming growth factor beta production Source: UniProtKB
Positive regulation of fibroblast proliferation Source: UniProtKB
Positive regulation of gene expression Source: UniProtKB
Positive regulation of substrate-dependent cell migration, cell attachment to substrate Source: UniProtKB
Cellular Location
Extracellular matrix
Involvement in disease
A chromosomal aberration involving FBLN1 is found in a complex type of synpolydactyly referred to as 3/3-prime/4 synpolydactyly associated with metacarpal and metatarsal synostoses. Reciprocal translocation t(12;22)(p11.2;q13.3) with RASSF8. Fibroblasts derived from a patient with synpolydactyly displayed alterations in the level of isoform D splice variant incorporated into the ECM and secreted into the conditioned culture medium. By contrast, the expression of isoform C was not perturbed in the patients fibroblasts. Furthermore, no aberrant polypeptides were detected in extracts of cultured patients fibroblasts. The translocation t(12;22) may result in haploinsufficiency of the isoform D splice variant, which could lead to the observed limb malformation.
Elevated expression and altered processing of FBLN1 protein is associated with human breast cancer.
More Infomation

McCoy, M. D., Sarasua, S. M., DeLuca, J. M., Davis, S., Phelan, K., Rogers, R. C., & Boccuto, L. (2022). State of the Science for Kidney Disorders in Phelan-McDermid Syndrome: UPK3A, FBLN1, WNT7B, and CELSR1 as Candidate Genes. Genes, 13(6), 1042.

Xu, G., Geng, X., Yang, F., & Zhang, H. (2022). FBLN1 promotes chondrocyte proliferation by increasing phosphorylation of Smad2. Journal of Orthopaedic Science, 27(1), 242-248.

Watkins, J. C., & Roberts, D. J. (2022). Placenta-associated uterine inflammatory myofibroblastic tumor with a novel FBLN1-ALK1 fusion. Human Pathology Reports, 28, 300647.

Mamoor, S. (2022). Differential expression of FBLN1 in amyotrophic lateral sclerosis.

Raman, R., Alison, S. D. C., Cyrille, D., Zappia, J., Mishal, A., da Silva Caroline, C., ... & Muller, M. (2022, September). Osteoblast Transcriptome in 4 days old zebrafish larvae and the role of Fbln1 and Col10a1a bone extracellular matrix proteins during skeletal development. In German Society for Matrix biology (Deutsche Gesellschaft fuer Matrixbiologie eV) DGMB 2022.

Hao, Y., Ye, M., Chen, X., Zhao, H., Hasim, A., & Guo, X. (2021). Discovery and validation of FBLN1 and ANT3 as potential biomarkers for early detection of cervical cancer. Cancer cell international, 21(1), 1-13.

Liu, X. T., Liu, T. T., Wu, M. Y., Chen, Q. X., Zhuang, J. X., & Wang, Q. (2021). Identifying FBLN1 (Gene ID: 2192) as a Potential Melanoma Biomarker for Melanoma based on an Analysis of microRNA Expression Profiles in the GEO and TCGA Databases. Genetic Testing and Molecular Biomarkers, 25(1), 68-78.

Watany, M. M., Elmashad, N. M., Badawi, R., & Hawash, N. (2018). Serum FBLN1 and STK31 as biomarkers of colorectal cancer and their ability to noninvasively differentiate colorectal cancer from benign polyps. Clinica Chimica Acta, 483, 151-155.

Ask a question We look forward to hearing from you.
0 reviews or Q&As
Loading...
Have you used Mouse Anti-FBLN1 Recombinant Antibody (CL0337)?
Submit a review and get a Coupon or an Amazon gift card. 20% off Coupon $30 eGift Card
Submit a review
Loading...
For research use only. Not intended for any clinical use.

Custom Antibody Labeling

We also offer labeled antibodies developed using our catalog antibody products and nonfluorescent conjugates (HRP, AP, Biotin, etc.) or fluorescent conjugates (Alexa Fluor, FITC, TRITC, Rhodamine, Texas Red, R-PE, APC, Qdot Probes, Pacific Dyes, etc.).

Learn more

Documents

Contact us

  • Tel: (USA)
  • (UK)
  • Fax:
  • Email:

Submit A Review

Online Inquiry