Search :
Sign in or Register  
Welcome Sign in or Don't have an account?Register

Mouse Anti-HMGB1 Recombinant Antibody (5H3) (CBMAB-BR260LY)

Online Inquiry

Summary

Host Animal
Mouse
Specificity
Human, Monkey, Mouse, Rat
Clone
5H3
Antibody Isotype
IgG2b
Application
FC: 1-3 μg/1x10 cells, IHC-P: 0.5-1 μg/ml, WB: 0.1-0.5 μg/ml

Basic Information

Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human HMGB1 (124-154aa DVAKKLGEMWNNTAADDKQPYEKKAAKLKEK), identical to the related mouse and rat sequences.
Specificity
Human, Monkey, Mouse, Rat
Antibody Isotype
IgG2b
Clonality
Monoclonal
Application Notes
The COA includes recommended starting dilutions, optimal dilutions should be determined by the end user.

Formulations & Storage [For reference only, actual COA shall prevail!]

Format
Lyophilized
Preservative
0.05 mg sodium azide
Storage
Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freezethaw cycles.

Target

Full Name
High Mobility Group Box 1
Introduction
This gene encodes a protein that belongs to the High Mobility Group-box superfamily. The encoded non-histone, nuclear DNA-binding protein regulates transcription, and is involved in organization of DNA. This protein plays a role in several cellular processes, including inflammation, cell differentiation and tumor cell migration. Multiple pseudogenes of this gene have been identified. Alternative splicing results in multiple transcript variants that encode the same protein. [provided by RefSeq, Sep 2015]
Entrez Gene ID
Human3146
Mouse15289
Rat25459
Monkey712849
UniProt ID
HumanP09429
MouseP63158
RatP63159
MonkeyQ4R844
Alternative Names
High mobility group protein B1; High mobility group protein 1; HMG-1; HMGB1; HMG1
Function
Multifunctional redox sensitive protein with various roles in different cellular compartments. In the nucleus is one of the major chromatin-associated non-histone proteins and acts as a DNA chaperone involved in replication, transcription, chromatin remodeling, V(D)J recombination, DNA repair and genome stability (Ref. 71). Proposed to be an universal biosensor for nucleic acids. Promotes host inflammatory response to sterile and infectious signals and is involved in the coordination and integration of innate and adaptive immune responses. In the cytoplasm functions as sensor and/or chaperone for immunogenic nucleic acids implicating the activation of TLR9-mediated immune responses, and mediates autophagy. Acts as danger associated molecular pattern (DAMP) molecule that amplifies immune responses during tissue injury (PubMed:27362237).

Released to the extracellular environment can bind DNA, nucleosomes, IL-1 beta, CXCL12, AGER isoform 2/sRAGE, lipopolysaccharide (LPS) and lipoteichoic acid (LTA), and activates cells through engagement of multiple surface receptors. In the extracellular compartment fully reduced HMGB1 (released by necrosis) acts as a chemokine, disulfide HMGB1 (actively secreted) as a cytokine, and sulfonyl HMGB1 (released from apoptotic cells) promotes immunological tolerance (PubMed:23519706, PubMed:23446148, PubMed:23994764, PubMed:25048472).

Has proangiogdenic activity (By similarity).

May be involved in platelet activation (By similarity).

Binds to phosphatidylserine and phosphatidylethanolamide (By similarity).

Bound to RAGE mediates signaling for neuronal outgrowth (By similarity).

May play a role in accumulation of expanded polyglutamine (polyQ) proteins such as huntingtin (HTT) or TBP (PubMed:23303669, PubMed:25549101).

Nuclear functions are attributed to fully reduced HGMB1. Associates with chromatin and binds DNA with a preference to non-canonical DNA structures such as single-stranded DNA, DNA-containing cruciforms or bent structures, supercoiled DNA and ZDNA. Can bent DNA and enhance DNA flexibility by looping thus providing a mechanism to promote activities on various gene promoters by enhancing transcription factor binding and/or bringing distant regulatory sequences into close proximity (PubMed:20123072).

May have an enhancing role in nucleotide excision repair (NER) (By similarity).

However, effects in NER using in vitro systems have been reported conflictingly (PubMed:19446504, PubMed:19360789).

May be involved in mismatch repair (MMR) and base excision repair (BER) pathways (PubMed:15014079, PubMed:16143102, PubMed:17803946).

May be involved in double strand break repair such as non-homologous end joining (NHEJ) (By similarity).

Involved in V(D)J recombination by acting as a cofactor of the RAG complex: acts by stimulating cleavage and RAG protein binding at the 23 bp spacer of conserved recombination signal sequences (RSS) (By similarity).

In vitro can displace histone H1 from highly bent DNA (By similarity).

Can restructure the canonical nucleosome leading to relaxation of structural constraints for transcription factor-binding (By similarity).

Enhances binding of sterol regulatory element-binding proteins (SREBPs) such as SREBF1 to their cognate DNA sequences and increases their transcriptional activities (By similarity).

Facilitates binding of TP53 to DNA (PubMed:23063560).

Proposed to be involved in mitochondrial quality control and autophagy in a transcription-dependent fashion implicating HSPB1; however, this function has been questioned (By similarity).

Can modulate the activity of the telomerase complex and may be involved in telomere maintenance (By similarity).

In the cytoplasm proposed to dissociate the BECN1:BCL2 complex via competitive interaction with BECN1 leading to autophagy activation (PubMed:20819940).

Involved in oxidative stress-mediated autophagy (PubMed:21395369).

Can protect BECN1 and ATG5 from calpain-mediated cleavage and thus proposed to control their proautophagic and proapoptotic functions and to regulate the extent and severity of inflammation-associated cellular injury (By similarity).

In myeloid cells has a protective role against endotoxemia and bacterial infection by promoting autophagy (By similarity).

Involved in endosomal translocation and activation of TLR9 in response to CpG-DNA in macrophages (By similarity).

In the extracellular compartment (following either active secretion or passive release) involved in regulation of the inflammatory response. Fully reduced HGMB1 (which subsequently gets oxidized after release) in association with CXCL12 mediates the recruitment of inflammatory cells during the initial phase of tissue injury; the CXCL12:HMGB1 complex triggers CXCR4 homodimerization (PubMed:22370717).

Induces the migration of monocyte-derived immature dendritic cells and seems to regulate adhesive and migratory functions of neutrophils implicating AGER/RAGE and ITGAM (By similarity).

Can bind to various types of DNA and RNA including microbial unmethylated CpG-DNA to enhance the innate immune response to nucleic acids. Proposed to act in promiscuous DNA/RNA sensing which cooperates with subsequent discriminative sensing by specific pattern recognition receptors (By similarity).

Promotes extracellular DNA-induced AIM2 inflammasome activation implicating AGER/RAGE (PubMed:24971542).

Disulfide HMGB1 binds to transmembrane receptors, such as AGER/RAGE, TLR2, TLR4 and probably TREM1, thus activating their signal transduction pathways. Mediates the release of cytokines/chemokines such as TNF, IL-1, IL-6, IL-8, CCL2, CCL3, CCL4 and CXCL10 (PubMed:12765338, PubMed:18354232, PubMed:19264983, PubMed:20547845, PubMed:24474694).

Promotes secretion of interferon-gamma by macrophage-stimulated natural killer (NK) cells in concert with other cytokines like IL-2 or IL-12 (PubMed:15607795).

TLR4 is proposed to be the primary receptor promoting macrophage activation and signaling through TLR4 seems to implicate LY96/MD-2 (PubMed:20547845).

In bacterial LPS- or LTA-mediated inflammatory responses binds to the endotoxins and transfers them to CD14 for signaling to the respective TLR4:LY96 and TLR2 complexes (PubMed:18354232, PubMed:21660935, PubMed:25660311).

Contributes to tumor proliferation by association with ACER/RAGE (By similarity).

Can bind to IL1-beta and signals through the IL1R1:IL1RAP receptor complex (PubMed:18250463).

Binding to class A CpG activates cytokine production in plasmacytoid dendritic cells implicating TLR9, MYD88 and AGER/RAGE and can activate autoreactive B cells. Via HMGB1-containing chromatin immune complexes may also promote B cell responses to endogenous TLR9 ligands through a B-cell receptor (BCR)-dependent and ACER/RAGE-independent mechanism (By similarity).

Inhibits phagocytosis of apoptotic cells by macrophages; the function is dependent on poly-ADP-ribosylation and involves binding to phosphatidylserine on the cell surface of apoptotic cells (By similarity).

In adaptive immunity may be involved in enhancing immunity through activation of effector T cells and suppression of regulatory T (TReg) cells (PubMed:15944249, PubMed:22473704).

In contrast, without implicating effector or regulatory T-cells, required for tumor infiltration and activation of T-cells expressing the lymphotoxin LTA:LTB heterotrimer thus promoting tumor malignant progression (By similarity).

Also reported to limit proliferation of T-cells (By similarity).

Released HMGB1:nucleosome complexes formed during apoptosis can signal through TLR2 to induce cytokine production (PubMed:19064698).

Involved in induction of immunological tolerance by apoptotic cells; its pro-inflammatory activities when released by apoptotic cells are neutralized by reactive oxygen species (ROS)-dependent oxidation specifically on Cys-106 (PubMed:18631454).

During macrophage activation by activated lymphocyte-derived self apoptotic DNA (ALD-DNA) promotes recruitment of ALD-DNA to endosomes (By similarity).

(Microbial infection) Critical for entry of human coronaviruses SARS-CoV and SARS-CoV-2, as well as human coronavirus NL63/HCoV-NL63. Regulates the expression of the pro-viral genes ACE2 and CTSL through chromatin modulation.
Biological Process
Activation of innate immune response Source: UniProtKB
Apoptotic cell clearance Source: UniProtKB
Autophagy Source: UniProtKB-KW
Cellular response to lipopolysaccharide Source: ARUK-UCL
Dendritic cell chemotaxis Source: UniProtKB
DNA geometric change Source: AgBase
DNA recombination Source: UniProtKB
DNA topological change Source: UniProtKB
Double-strand break repair via nonhomologous end joining Source: UniProtKB
Gene silencing Source: GO_Central
Inflammatory response Source: CACAO
Inflammatory response to antigenic stimulus Source: UniProtKB
Innate immune response Source: UniProtKB-KW
Myeloid dendritic cell activation Source: UniProtKB
Negative regulation of apoptotic cell clearance Source: BHF-UCL
Negative regulation of blood vessel endothelial cell migration Source: CACAO
Negative regulation of CD4-positive, alpha-beta T cell differentiation Source: UniProtKB
Negative regulation of interferon-gamma production Source: UniProtKB
Negative regulation of RNA polymerase II transcription preinitiation complex assembly Source: UniProtKB
Negative regulation of transcription by RNA polymerase II Source: UniProtKB
Neuron projection development Source: UniProtKB
Neutrophil clearance Source: UniProtKB
Positive regulation of activated T cell proliferation Source: UniProtKB
Positive regulation of apoptotic process Source: UniProtKB
Positive regulation of autophagy Source: UniProtKB
Positive regulation of blood vessel endothelial cell migration Source: BHF-UCL
Positive regulation of chemokine (C-X-C motif) ligand 2 production Source: CACAO
Positive regulation of cysteine-type endopeptidase activity involved in apoptotic process Source: UniProtKB
Positive regulation of cytosolic calcium ion concentration Source: UniProtKB
Positive regulation of dendritic cell differentiation Source: UniProtKB
Positive regulation of DNA binding Source: UniProtKB
Positive regulation of DNA ligation Source: UniProtKB
Positive regulation of ERK1 and ERK2 cascade Source: UniProtKB
Positive regulation of interleukin-10 production Source: UniProtKB
Positive regulation of interleukin-12 production Source: UniProtKB
Positive regulation of interleukin-1 production Source: UniProtKB
Positive regulation of interleukin-6 production Source: UniProtKB
Positive regulation of interleukin-8 production Source: CACAO
Positive regulation of JNK cascade Source: UniProtKB
Positive regulation of MAPK cascade Source: UniProtKB
Positive regulation of mismatch repair Source: UniProtKB
Positive regulation of monocyte chemotaxis Source: UniProtKB
Positive regulation of toll-like receptor 9 signaling pathway Source: UniProtKB
Positive regulation of transcription by RNA polymerase II Source: UniProtKB
Positive regulation of tumor necrosis factor production Source: UniProtKB
Positive regulation of vascular endothelial cell proliferation Source: BHF-UCL
Regulation of restriction endodeoxyribonuclease activity Source: UniProtKB
Regulation of T cell mediated immune response to tumor cell Source: UniProtKB
Regulation of tolerance induction Source: UniProtKB
Regulation of transcription by RNA polymerase II Source: GO_Central
T-helper 1 cell activation Source: UniProtKB
T-helper 1 cell differentiation Source: UniProtKB
V(D)J recombination Source: UniProtKB
Cellular Location
Secreted; Nucleus; Cell membrane; Endosome; Cytoplasm; Chromosome; Endoplasmic reticulum-Golgi intermediate compartment. In basal state predominantly nuclear. Shuttles between the cytoplasm and the nucleus (PubMed:12231511, PubMed:17114460). Translocates from the nucleus to the cytoplasm upon autophagy stimulation (PubMed:20819940). Release from macrophages in the extracellular milieu requires the activation of NLRC4 or NLRP3 inflammasomes (By similarity). Passively released to the extracellular milieu from necrotic cells by diffusion, involving the fully reduced HGMB1 which subsequently gets oxidized (PubMed:19811284). Also released from apoptotic cells (PubMed:16855214, PubMed:18631454). Active secretion from a variety of immune and non-immune cells such as macrophages, monocytes, neutrophils, dendritic cells and natural killer cells in response to various stimuli such as LPS and cytokines involves a nonconventional secretory process via secretory lysosomes (PubMed:12231511, PubMed:14532127, PubMed:15944249). Secreted by plasma cells in response to LPS (By similarity). Found on the surface of activated platelets (PubMed:11154118). An increased chromatin association is observed when associated with the adenovirus protein pVII (PubMed:27362237).
PTM
Phosphorylated at serine residues. Phosphorylation in both NLS regions is required for cytoplasmic translocation followed by secretion (PubMed:17114460).
Acetylated on multiple sites upon stimulation with LPS (PubMed:22801494). Acetylation on lysine residues in the nuclear localization signals (NLS 1 and NLS 2) leads to cytoplasmic localization and subsequent secretion (By similarity). Acetylation on Lys-3 results in preferential binding to DNA ends and impairs DNA bending activity (By similarity).
Reduction/oxidation of cysteine residues Cys-23, Cys-45 and Cys-106 and a possible intramolecular disulfide bond involving Cys-23 and Cys-45 give rise to different redox forms with specific functional activities in various cellular compartments: 1- fully reduced HMGB1 (HMGB1C23hC45hC106h), 2- disulfide HMGB1 (HMGB1C23-C45C106h) and 3- sulfonyl HMGB1 (HMGB1C23soC45soC106so).
Poly-ADP-ribosylated by PARP1 when secreted following stimulation with LPS (By similarity).
In vitro cleavage by CASP1 is liberating a HMG box 1-containing peptide which may mediate immunogenic activity; the peptide antagonizes apoptosis-induced immune tolerance (PubMed:24474694). Can be proteolytically cleaved by a thrombin:thrombomodulin complex; reduces binding to heparin and proinflammatory activities (By similarity).
Forms covalent cross-links mediated by transglutaminase TGM2, between a glutamine and the epsilon-amino group of a lysine residue, forming homopolymers and heteropolymers.
More Infomation
Ask a question We look forward to hearing from you.
0 reviews or Q&As
Loading...
Have you used Mouse Anti-HMGB1 Recombinant Antibody (5H3)?
Submit a review and get a Coupon or an Amazon gift card. 20% off Coupon $30 eGift Card
Submit a review
Loading...
For research use only. Not intended for any clinical use.

Custom Antibody Labeling

We also offer labeled antibodies developed using our catalog antibody products and nonfluorescent conjugates (HRP, AP, Biotin, etc.) or fluorescent conjugates (Alexa Fluor, FITC, TRITC, Rhodamine, Texas Red, R-PE, APC, Qdot Probes, Pacific Dyes, etc.).

Learn more

Documents

Contact us

  • Tel: (USA)
  • (UK)
  • Fax:
  • Email:

Submit A Review

Online Inquiry