Sign in or Register   Sign in or Register
  |  

Mouse Anti-HMGB3 Recombinant Antibody (7G13) (CBMAB-BR258LY)

The product is antibody recognizes HMG4. The antibody 7G13 immunoassay techniques such as: FC, IF, IHC-P, ICC, WB.
See all HMGB3 antibodies

Summary

Host Animal
Mouse
Specificity
Human
Clone
7G13
Antibody Isotype
IgG2B
Application
FC: 1-3 μg/1x10 cells, IF: 1:1000 dilution, IHC-P: 0.5-1 μg/ml, ICC: 1:200 dilution, WB: 0.1-0.5 μg/ml

Basic Information

Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human HMG4 (62-95aa EMAKADKVRYDREMKDYGPAKGGKKKKDPNAPKR), identical to the related mouse and rat sequences.
Specificity
Human
Antibody Isotype
IgG2B
Application Notes
The COA includes recommended starting dilutions, optimal dilutions should be determined by the end user.

Formulations & Storage [For reference only, actual COA shall prevail!]

Format
Lyophilized
Preservative
0.05 mg sodium azide
Storage
Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freezethaw cycles.

Target

Full Name
High Mobility Group Box 3
Entrez Gene ID
UniProt ID
Alternative Names
"chromosomal protein, Nonhistone, HMG4 antibody|High mobility group (nonhistone chromosomal) protein 4 antibody|High mobility group box 3 antibody|High mobility group protein 2a antibody|High mobility group protein 4 antibody|High mobility group protein B3 antibody|
High mobility group protein HMG4 antibody|HMG 4 antibody|HMG-2a antibody|HMG-4 antibody|HMG2A antibody|HMGB 3 antibody|HMGB3 antibody| HMGB3_HUMAN antibody|MGC90319 antibody|Non histone chromosomal protein antibody|Nonhistone chromosomal protein HMG4 antibody"
Function
Multifunctional protein with various roles in different cellular compartments. May act in a redox sensitive manner. Associates with chromatin and binds DNA with a preference to non-canonical DNA structures such as single-stranded DNA. Can bent DNA and enhance DNA flexibility by looping thus providing a mechanism to promote activities on various gene promoters (By similarity).

Proposed to be involved in the innate immune response to nucleic acids by acting as a cytoplasmic promiscuous immunogenic DNA/RNA sensor (By similarity).

Negatively regulates B-cell and myeloid cell differentiation. In hematopoietic stem cells may regulate the balance between self-renewal and differentiation. Involved in negative regulation of canonical Wnt signaling (By similarity).
Biological Process
DNA geometric change Source: AgBase
DNA recombination Source: UniProtKB
Innate immune response Source: UniProtKB-KW
Negative regulation of B cell differentiation Source: Ensembl
Negative regulation of myeloid cell differentiation Source: Ensembl
Regulation of transcription by RNA polymerase II Source: GO_Central
Cellular Location
Nucleus; Cytoplasm; Chromosome
Involvement in disease
Microphthalmia, syndromic, 13 (MCOPS13):
A form of microphthalmia, a disorder of eye formation, ranging from small size of a single eye to complete bilateral absence of ocular tissues (anophthalmia). In many cases, microphthalmia/anophthalmia occurs in association with syndromes that include non-ocular abnormalities. MCOPS13 patients exhibit colobomatous microphthalmia with microcephaly, short stature, and psychomotor retardation.
PTM
Reduction/oxidation of cysteine residues Cys-23, Cys-45 and Cys-104 and a possible intramolecular disulfide bond involving Cys-23 and Cys-45 give rise to different redox forms with specific functional activities in various cellular compartments: 1- fully reduced HMGB3 (HMGB3C23hC45hC104h), 2- disulfide HMGB3 (HMGB3C23-C45C104h) and 3- sulfonyl HMGB3 (HMGB3C23soC45soC104so).

Ma, H., Qi, G., Han, F., Lu, W., Peng, J., Li, R., ... & Kong, B. (2022). HMGB3 promotes PARP inhibitor resistance through interacting with PARP1 in ovarian cancer. Cell Death & Disease, 13(3), 263.

Gu, M., Jiang, Z., Li, H., Peng, J., Chen, X., & Tang, M. (2021). MiR-93/HMGB3 regulatory axis exerts tumor suppressive effects in colorectal carcinoma cells. Experimental and Molecular Pathology, 120, 104635.

Wen, B., Wei, Y. T., & Zhao, K. (2021). The role of high mobility group protein B3 (HMGB3) in tumor proliferation and drug resistance. Molecular and Cellular Biochemistry, 476(4), 1729-1739.

Yin, K., & Liu, X. (2020). CircMMP1 promotes the progression of glioma through miR‐433/HMGB3 axis in vitro and in vivo. IUBMB life, 72(11), 2508-2524.

Liu, D., Wang, Y., Zhao, Y., & Gu, X. (2020). LncRNA SNHG5 promotes nasopharyngeal carcinoma progression by regulating miR-1179/HMGB3 axis. Bmc Cancer, 20(1), 1-11.

Xie, Y., Wang, L., & Yang, D. (2020). CircEPSTI1 promotes the progression of non-small cell lung cancer through miR-145/HMGB3 axis. Cancer Management and Research, 6827-6836.

Song, X., Wang, H., Wu, J., & Sun, Y. (2020). Long noncoding RNA SOX2-OT knockdown inhibits proliferation and metastasis of prostate cancer cells through modulating the miR-452-5p/HMGB3 axis and inactivating Wnt/β-catenin pathway. Cancer biotherapy & radiopharmaceuticals, 35(9), 682-695.

Zhou, Z. F., Wei, Z., Yao, J. C., Liu, S. Y., Wang, F., Wang, Z., ... & Zheng, Q. F. (2020). CircRNA_102179 promotes the proliferation, migration and invasion in non-small cell lung cancer cells by regulating miR-330-5p/HMGB3 axis. Pathology-Research and Practice, 216(11), 153144.

Xie, X., Pan, J., Han, X., & Chen, W. (2019). Downregulation of microRNA-532-5p promotes the proliferation and invasion of bladder cancer cells through promotion of HMGB3/Wnt/β-catenin signaling. Chemico-biological interactions, 300, 73-81.

Shi, J., Wang, H., Feng, W., Huang, S., An, J., Qiu, Y., & Wu, K. (2019). Long non-coding RNA HOTTIP promotes hypoxia-induced glycolysis through targeting miR-615-3p/HMGB3 axis in non-small cell lung cancer cells. European journal of pharmacology, 862, 172615.

Ask a question We look forward to hearing from you.
0 reviews or Q&As
Loading...
Have you used Mouse Anti-HMGB3 Recombinant Antibody (7G13)?
Submit a review and get a Coupon or an Amazon gift card. 20% off Coupon $30 eGift Card
Submit a review
Loading...
For research use only. Not intended for any clinical use.

Custom Antibody Labeling

We also offer labeled antibodies developed using our catalog antibody products and nonfluorescent conjugates (HRP, AP, Biotin, etc.) or fluorescent conjugates (Alexa Fluor, FITC, TRITC, Rhodamine, Texas Red, R-PE, APC, Qdot Probes, Pacific Dyes, etc.).

Online Inquiry

Documents

Contact us

  • Tel: (USA)
  • (UK)
  • Fax:
  • Email:

Submit A Review

Go to
Compare