Mouse Anti-HNF1B Recombinant Antibody (CBYJT-1377) (CBMAB-T0399-YJ)

Go to compare Compare Online Inquiry
Request for COA
Datasheet Target References Q & As Review & reward Protocols Associated Products

Basic Information

Host Animal
Mouse
Clone
CBYJT-1377
Application
WB, IHC, ICC, IF, IHC-P
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: KEVLVQALEELLPSPNFGVKLETLPLSPGSGAEPDTKPVFHTLTNGHAKGRLSGDEGSEDGDDYDTPPILKELQALNTEEAAEQRAEVDRMLSEDPWRAAKMIKGYMQQH
Specificity
Human
Antibody Isotype
IgG1
Clonality
Monoclonal
Application Notes
The COA includes recommended starting dilutions, optimal dilutions should be determined by the end user.

Formulations & Storage [For reference only, actual COA shall prevail!]

Buffer
PBS, pH 7.4
Storage
Store at 4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze/thaw cycles.
More Infomation

Target

Full Name
HNF1 Homeobox B
Introduction
HNF1B is a member of the homeodomain-containing superfamily of transcription factors. HNF1B binds to DNA as either a homodimer, or a heterodimer with the related protein hepatocyte nuclear factor 1-alpha. HNF1B has been shown to function in nephron development, and regulates development of the embryonic pancreas. Mutations in HNF1B result in renal cysts and diabetes syndrome and noninsulin-dependent diabetes mellitus, and expression of HNF1B is altered in some types of cancer.
Entrez Gene ID
UniProt ID
Alternative Names
HNF1 Homeobox B; Homeoprotein LFB3; HNF-1-Beta; HNF-1B; VHNF1; TCF-2; TCF2; Transcription Factor 2, Hepatic; LF-B3; Variant Hepatic Nuclear Factor; Hepatocyte Nuclear Factor 1-Beta; Variant Hepatic Nuclear Factor 1; Transcription Factor 2, Hepatic
Function
Transcription factor that binds to the inverted palindrome 5'-GTTAATNATTAAC-3' (PubMed:7900999, PubMed:17924661).

Binds to the FPC element in the cAMP regulatory unit of the PLAU gene (By similarity).

Transcriptional activity is increased by coactivator PCBD1 (PubMed:24204001).
Biological Process
Anterior/posterior pattern specification Source: Ensembl
Branching morphogenesis of an epithelial tube Source: Ensembl
Circadian regulation of gene expression Source: Ensembl
Embryonic digestive tract morphogenesis Source: Ensembl
Endocrine pancreas development Source: UniProtKB
Endodermal cell fate specification Source: Ensembl
Epithelial cell proliferation Source: Ensembl
Genitalia development Source: UniProtKB
Hepatoblast differentiation Source: Ensembl
Hepatocyte differentiation Source: Ensembl
Hindbrain development Source: Ensembl
Inner cell mass cell differentiation Source: Ensembl
Insulin secretion Source: Ensembl
Kidney development Source: UniProtKB
Mesonephric duct formation Source: Ensembl
Negative regulation of mesenchymal cell apoptotic process involved in mesonephric nephron morphogenesis Source: Ensembl
Negative regulation of mesenchymal cell apoptotic process involved in metanephros development Source: Ensembl
Negative regulation of transcription by RNA polymerase II Source: Ensembl
Notch signaling pathway Source: Ensembl
Pancreas development Source: InterPro
Positive regulation of gene expression Source: Ensembl
Positive regulation of transcription, DNA-templated Source: UniProtKB
Positive regulation of transcription initiation from RNA polymerase II promoter Source: UniProtKB
Pronephric nephron tubule development Source: UniProtKB
Pronephros development Source: UniProtKB
Protein-DNA complex assembly Source: Ensembl
Regulation of branch elongation involved in ureteric bud branching Source: Ensembl
Regulation of pronephros size Source: UniProtKB
Regulation of transcription by RNA polymerase II Source: GO_Central
Regulation of Wnt signaling pathway Source: Ensembl
Response to glucose Source: Ensembl
Response to organic cyclic compound Source: Ensembl
Response to xenobiotic stimulus Source: Ensembl
Ureteric bud elongation Source: Ensembl
Cellular Location
Nucleus
Involvement in disease
Renal cysts and diabetes syndrome (RCAD):
An autosomal dominant disorder comprising non-diabetic renal disease resulting from abnormal renal development, and diabetes, which in some cases occurs earlier than age 25 years and is thus consistent with a diagnosis of maturity-onset diabetes of the young (MODY5). The renal disease is highly variable and includes renal cysts, glomerular tufts, aberrant nephrogenesis, primitive tubules, irregular collecting systems, oligomeganephronia, enlarged renal pelves, abnormal calyces, small kidney, single kidney, horseshoe kidney, and hyperuricemic nephropathy. Affected individuals may also have abnormalities of the genital tract.
Diabetes mellitus, non-insulin-dependent (NIDDM):
A multifactorial disorder of glucose homeostasis caused by a lack of sensitivity to the body's own insulin. Affected individuals usually have an obese body habitus and manifestations of a metabolic syndrome characterized by diabetes, insulin resistance, hypertension and hypertriglyceridemia. The disease results in long-term complications that affect the eyes, kidneys, nerves, and blood vessels.
Prostate cancer, hereditary, 11 (HPC11):
A condition associated with familial predisposition to cancer of the prostate. Most prostate cancers are adenocarcinomas that develop in the acini of the prostatic ducts. Other rare histopathologic types of prostate cancer that occur in approximately 5% of patients include small cell carcinoma, mucinous carcinoma, prostatic ductal carcinoma, transitional cell carcinoma, squamous cell carcinoma, basal cell carcinoma, adenoid cystic carcinoma (basaloid), signet-ring cell carcinoma and neuroendocrine carcinoma.

Gambella, A., Kalantari, S., Cadamuro, M., Quaglia, M., Delvecchio, M., Fabris, L., & Pinon, M. (2023). The Landscape of HNF1B Deficiency: A Syndrome Not Yet Fully Explored. Cells, 12(2), 307.

Grand, K., Stoltz, M., Rizzo, L., Röck, R., Kaminski, M. M., Salinas, G., ... & Lienkamp, S. S. (2023). HNF1B alters an evolutionarily conserved nephrogenic program of target genes. The Journal of the American Society of Nephrology, 34(3), 412-432.

Nittel, C. M., Dobelke, F., König, J., Konrad, M., Becker, K., Kamp-Becker, I., & Weber, S. (2023). Review of neurodevelopmental disorders in patients with HNF1B gene variations. Frontiers in Pediatrics, 11, 1149875.

Kołbuc, M., Leßmeier, L., Salamon-Słowińska, D., Małecka, I., Pawlaczyk, K., Walkowiak, J., ... & Zaniew, M. (2020). Hypomagnesemia is underestimated in children with HNF1B mutations. Pediatric Nephrology, 35, 1877-1886.

Lim, S. H., Kim, J. H., Han, K. H., Ahn, Y. H., Kang, H. G., Ha, I. S., & Cheong, H. I. (2020). Genotype and phenotype analyses in pediatric patients with HNF1B mutations. Journal of Clinical Medicine, 9(7), 2320.

Adalat, S., Hayes, W. N., Bryant, W. A., Booth, J., Woolf, A. S., Kleta, R., ... & Bockenhauer, D. (2019). HNF1B mutations are associated with a Gitelman-like tubulopathy that develops during childhood. Kidney international reports, 4(9), 1304-1311.

Nagano, C., Morisada, N., Nozu, K., Kamei, K., Tanaka, R., Kanda, S., ... & Iijima, K. (2019). Clinical characteristics of HNF1B-related disorders in a Japanese population. Clinical and Experimental Nephrology, 23, 1119-1129.

Okorn, C., Goertz, A., Vester, U., Beck, B. B., Bergmann, C., Habbig, S., ... & Weber, S. (2019). HNF1B nephropathy has a slow-progressive phenotype in childhood—with the exception of very early onset cases: results of the German Multicenter HNF1B Childhood Registry. Pediatric Nephrology, 34, 1065-1075.

Bártů, M., Dundr, P., Němejcová, K., Tichá, I., Hojný, H., & Hájková, N. (2018). The Role of HNF1B in Tumorigenesis of Solid Tumours: a Review of Current Knowledge. Folia Biologica (00155500), 64(3).

Chan, S. C., Zhang, Y., Shao, A., Avdulov, S., Herrera, J., Aboudehen, K., ... & Igarashi, P. (2018). Mechanism of fibrosis in HNF1B-related autosomal dominant tubulointerstitial kidney disease. Journal of the American Society of Nephrology: JASN, 29(10), 2493.

Ask a question We look forward to hearing from you.
0 reviews or Q&As
Loading...
Have you used Mouse Anti-HNF1B Recombinant Antibody (CBYJT-1377)?
Submit a review and get a Coupon or an Amazon gift card. 20% off Coupon $30 eGift Card
Submit a review
Loading...
For research use only. Not intended for any clinical use.

Custom Antibody Labeling

We also offer labeled antibodies developed using our catalog antibody products and nonfluorescent conjugates (HRP, AP, Biotin, etc.) or fluorescent conjugates (Alexa Fluor, FITC, TRITC, Rhodamine, Texas Red, R-PE, APC, Qdot Probes, Pacific Dyes, etc.).

Online Inquiry

Contact us

  • Tel: (USA)
  • (UK)
  • Fax:
  • Email:

Submit A Review

online inquiry
Online Inquiry

This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.