Sign in or Register   Sign in or Register
  |  

Mouse Anti-LAMA5 Recombinant Antibody (CL3118) (CBMAB-L0558-YJ)

Provided herein is a Mouse monoclonal antibody, which binds to Laminin Subunit Alpha 5 (LAMA5). The antibody can be used for immunoassay techniques, such as WB, IHC-P.
See all LAMA5 antibodies
Published Data

Summary

Host Animal
Mouse
Specificity
Human
Clone
CL3118
Antibody Isotype
IgG1
Application
WB, IHC-P

Basic Information

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LNLSSIILDVNQDRLTQRAIEASNAYSRILQAVQAAEDAAGQALQQADHTWATVVRQGLVDRAQQLLANSTALEEAMLQEQQRLGLVWAAL.
Specificity
Human
Antibody Isotype
IgG1
Clonality
Monoclonal
Application Notes
The COA includes recommended starting dilutions, optimal dilutions should be determined by the end user.

Formulations & Storage [For reference only, actual COA shall prevail!]

Buffer
PBS, pH 7.4
Storage
Store at 4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze/thaw cycles.

Target

Full Name
laminin, alpha 5
Introduction
LAMA5 is one of the vertebrate laminin alpha chains. Laminins, a family of extracellular matrix glycoproteins, are the major noncollagenous constituent of basement membranes. They have been implicated in a wide variety of biological processes including cell adhesion, differentiation, migration, signaling, neurite outgrowth and metastasis. Laminins are composed of 3 non identical chains: laminin alpha, beta and gamma (formerly A, B1, and B2, respectively) and they form a cruciform structure consisting of 3 short arms, each formed by a different chain, and a long arm composed of all 3 chains. Each laminin chain is a multidomain protein encoded by a distinct gene. LAMA5 is the alpha-5 subunit of of laminin-10 (laminin-511), laminin-11 (laminin-521) and laminin-15 (laminin-523). Among its related pathways are ERK Signaling and Focal Adhesion.
Entrez Gene ID
UniProt ID
Function
Binding to cells via a high affinity receptor, laminin is thought to mediate the attachment, migration and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components.
Biological Process
Animal organ morphogenesisManual Assertion Based On ExperimentIBA:GO_Central
Axon guidanceManual Assertion Based On ExperimentIBA:GO_Central
Branching involved in salivary gland morphogenesisIEA:Ensembl
Branching involved in ureteric bud morphogenesisIEA:Ensembl
Cell migrationManual Assertion Based On ExperimentIDA:UniProtKB
Cell-cell adhesionManual Assertion Based On ExperimentIBA:GO_Central
Cilium assemblyIEA:Ensembl
Hair follicle developmentIEA:Ensembl
Integrin-mediated signaling pathwayManual Assertion Based On ExperimentIMP:UniProtKB
Lung developmentIEA:Ensembl
Morphogenesis of a polarized epitheliumManual Assertion Based On ExperimentIBA:GO_Central
Morphogenesis of embryonic epitheliumIEA:Ensembl
Muscle organ developmentIEA:Ensembl
Neural crest cell migrationIEA:Ensembl
Odontogenesis of dentin-containing toothIEA:Ensembl
Protein localization to plasma membraneIEA:Ensembl
Regulation of cell adhesionIEA:InterPro
Regulation of cell migrationIEA:InterPro
Regulation of cell population proliferationIEA:Ensembl
Regulation of embryonic developmentIEA:InterPro
Substrate adhesion-dependent cell spreadingManual Assertion Based On ExperimentIDA:BHF-UCL
Tissue developmentManual Assertion Based On ExperimentIBA:GO_Central
Cellular Location
Secreted, extracellular space, extracellular matrix, basement membrane
Major component.

Luo, S., Liu, Z. G., Wang, J., Luo, J. X., Ye, X. G., Li, X., ... & Liao, W. P. (2022). Recessive LAMA5 variants associated with partial epilepsy and spasms in infancy. Frontiers in Molecular Neuroscience, 15, 825390.

Falcone, S., Nicol, T., Blease, A., Randles, M. J., Angus, E., Page, A., ... & Potter, P. K. (2022). A novel model of nephrotic syndrome results from a point mutation in Lama5 and is modified by genetic background. Kidney International, 101(3), 527-540.

Savige, J., & Harraka, P. (2021). Pathogenic LAMA5 variants and kidney disease. Kidney360, 2(12), 1876.

Taniguchi, Y., Sekiguchi, K., Tashiro, A., Sugawara, N., Sakaguchi, H., Umeda, C., ... & Nozu, K. (2021). Clear evidence of LAMA5 gene biallelic truncating variants causing infantile nephrotic syndrome. Kidney360, 2(12), 1968.

Zhang, X., Li, Q., Jiang, W., Xiong, X., Li, H., Zhao, J., & Qi, H. (2020). LAMA5 promotes human umbilical vein endothelial cells migration, proliferation, and angiogenesis and is decreased in preeclampsia. The Journal of Maternal-Fetal & Neonatal Medicine, 33(7), 1114-1124.

Napolitano, F., Di Iorio, V., Di Iorio, G., Melone, M. A. B., Gianfrancesco, F., Simonelli, F., ... & Sampaolo, S. (2019). Early posterior vitreous detachment is associated with LAMA5 dominant mutation. Ophthalmic Genetics, 40(1), 39-42.

Braun, D. A., Warejko, J. K., Ashraf, S., Tan, W., Daga, A., Schneider, R., ... & Hildebrandt, F. (2019). Genetic variants in the LAMA5 gene in pediatric nephrotic syndrome. Nephrology Dialysis Transplantation, 34(3), 485-493.

Gordon-Weeks, A., Lim, S. Y., Yuzhalin, A., Lucotti, S., Vermeer, J. A. F., Jones, K., ... & Muschel, R. J. (2019). Tumour-derived laminin α5 (LAMA5) promotes colorectal liver metastasis growth, branching angiogenesis and notch pathway inhibition. Cancers, 11(5), 630.

Voskarides, K., Papagregoriou, G., Hadjipanagi, D., Petrou, I., Savva, I., Elia, A., ... & Deltas, C. (2018). COL4A5 and LAMA5 variants co-inherited in familial hematuria: digenic inheritance or genetic modifier effect?. BMC nephrology, 19, 1-8.

Maselli, R. A., Arredondo, J., Vázquez, J., Chong, J. X., Bamshad, M. J., Nickerson, D. A., ... & McDonald, C. M. (2018). A presynaptic congenital myasthenic syndrome attributed to a homozygous sequence variant in LAMA5. Annals of the New York Academy of Sciences, 1413(1), 119-125.

Ask a question We look forward to hearing from you.
0 reviews or Q&As
Loading...
Have you used Mouse Anti-LAMA5 Recombinant Antibody (CL3118)?
Submit a review and get a Coupon or an Amazon gift card. 20% off Coupon $30 eGift Card
Submit a review
Loading...
For research use only. Not intended for any clinical use.

Custom Antibody Labeling

We also offer labeled antibodies developed using our catalog antibody products and nonfluorescent conjugates (HRP, AP, Biotin, etc.) or fluorescent conjugates (Alexa Fluor, FITC, TRITC, Rhodamine, Texas Red, R-PE, APC, Qdot Probes, Pacific Dyes, etc.).

Online Inquiry

Documents

Contact us

  • Tel: (USA)
  • (UK)
  • Fax:
  • Email:

Submit A Review

Go to
Compare