Search :
Sign in or Register  
Welcome Sign in or Don't have an account?Register

Mouse Anti-MAP3K1 Recombinant Antibody (A995) (CBMAB-AP4380LY)

Online Inquiry

Summary

Host Animal
Mouse
Specificity
Human
Clone
A995
Antibody Isotype
IgG2a, κ
Application
FC, IF, IHC, WB

Basic Information

Immunogen
Partial recombinant MAP3K1 (aa1211-1310) (SKNSMTLDLNSSSKCDDSFGCSSNSSNAVIPSDETVFTP-VEEKCRLDVNTELNSSIEDLLEASMPSSDTTVTFKSEVAVLSPEKAENDDTYKDDVNHNQK)
Specificity
Human
Antibody Isotype
IgG2a, κ
Clonality
Monoclonal
Application Notes
The COA includes recommended starting dilutions, optimal dilutions should be determined by the end user.

Formulations & Storage [For reference only, actual COA shall prevail!]

Format
Liquid
Purity
Affinity purity
Storage
Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freezethaw cycles.

Target

Full Name
Mitogen-Activated Protein Kinase Kinase Kinase 1
Introduction
The protein encoded by this gene is a serine/threonine kinase and is part of some signal transduction cascades, including the ERK and JNK kinase pathways as well as the NF-kappa-B pathway. The encoded protein is activated by autophosphorylation and requires magnesium as a cofactor in phosphorylating other proteins. This protein has E3 ligase activity conferred by a plant homeodomain (PHD) in its N-terminus and phospho-kinase activity conferred by a kinase domain in its C-terminus. [provided by RefSeq, Mar 2012]
Entrez Gene ID
UniProt ID
Alternative Names
Mitogen-Activated Protein Kinase Kinase Kinase 1; MEKK1; MAPK/ERK Kinase Kinase 1; MEK Kinase 1; MAPKKK1; MEKK 1;
Function
Component of a protein kinase signal transduction cascade (PubMed:9808624).
Activates the ERK and JNK kinase pathways by phosphorylation of MAP2K1 and MAP2K4 (PubMed:9808624).
May phosphorylate the MAPK8/JNK1 kinase (PubMed:17761173).
Activates CHUK and IKBKB, the central protein kinases of the NF-kappa-B pathway (PubMed:9808624).
Biological Process
Cellular response to mechanical stimulusManual Assertion Based On ExperimentIEP:UniProtKB
Fc-epsilon receptor signaling pathwayTAS:Reactome
Protein phosphorylation1 PublicationNAS:UniProtKB
Cellular Location
Cytoplasm
Cytosol
Involvement in disease
46,XY sex reversal 6 (SRXY6):
A disorder of sex development. Affected individuals have a 46,XY karyotype but present as phenotypically normal females.
PTM
Autophosphorylated.
More Infomation

Kuo, S. H., Wei, M. F., Lee, Y. H., Lin, J. C., Yang, W. C., Yang, S. Y., & Huang, C. S. (2023). MAP3K1 expression is associated with progression and poor prognosis of hormone receptor-positive, HER2-negative early-stage breast cancer. Cellular Oncology, 1-22.

Aziz, M. A., & Islam, M. S. (2023). MAP3K1 rs889312 polymorphism and cancer prognosis: A systematic review and meta‐analysis. Cancer Reports, 6(1), e1773.

Napoleon, J. V., Sagar, S., Kubica, S. P., Boghean, L., Kour, S., King, H. M., ... & Natarajan, A. (2022). Small-molecule IKKβ activation modulator (IKAM) targets MAP3K1 and inhibits pancreatic tumor growth. Proceedings of the National Academy of Sciences, 119(18), e2115071119.

Li, C., Zhang, G., Wang, Y., Chen, B., Li, K., Cao, L., ... & Liao, N. (2022). Spectrum of MAP3K1 mutations in breast cancer is luminal subtype‑predominant and related to prognosis. Oncology Letters, 23(2), 1-12.

Wang, J., Kimura, E., Mongan, M., & Xia, Y. (2021). Genetic Control of MAP3K1 in Eye Development and Sex Differentiation. Cells, 11(1), 34.

Al Shamsi, A., Al Hassani, N., Hamchou, M., Almazrouei, R., & Mhanni, A. (2020). A novel missense heterozygous mutation in MAP3K1 gene causes 46, XY disorder of sex development: case report and literature review. Molecular Genetics & Genomic Medicine, 8(11), e1514.

Wang, J., Zuo, J., Wahafu, A., Wang, M. D., Li, R. C., & Xie, W. F. (2020). Combined elevation of TRIB2 and MAP3K1 indicates poor prognosis and chemoresistance to temozolomide in glioblastoma. CNS neuroscience & therapeutics, 26(3), 297-308.

Carene, D., Tran-Dien, A., Lemonnier, J., Dalenc, F., Levy, C., Pierga, J. Y., ... & Michiels, S. (2020). Association between FGFR1 copy numbers, MAP3K1 mutations, and survival in axillary node-positive, hormone receptor-positive, and HER2-negative early breast cancer in the PACS04 and METABRIC studies. Breast Cancer Research and Treatment, 179(2), 387-401.

Nixon, M. J., Formisano, L., Mayer, I. A., Estrada, M. V., González-Ericsson, P. I., Isakoff, S. J., ... & Balko, J. M. (2019). PIK3CA and MAP3K1 alterations imply luminal A status and are associated with clinical benefit from pan-PI3K inhibitor buparlisib and letrozole in ER+ metastatic breast cancer. NPJ Breast Cancer, 5(1), 31.

Chamberlin, A., Huether, R., Machado, A. Z., Groden, M., Liu, H. M., Upadhyay, K., ... & Ostrer, H. (2019). Mutations in MAP3K1 that cause 46, XY disorders of sex development disrupt distinct structural domains in the protein. Human molecular genetics, 28(10), 1620-1628.

Ask a question We look forward to hearing from you.
0 reviews or Q&As
Loading...
Have you used Mouse Anti-MAP3K1 Recombinant Antibody (A995)?
Submit a review and get a Coupon or an Amazon gift card. 20% off Coupon $30 eGift Card
Submit a review
Loading...
For research use only. Not intended for any clinical use.

Custom Antibody Labeling

We also offer labeled antibodies developed using our catalog antibody products and nonfluorescent conjugates (HRP, AP, Biotin, etc.) or fluorescent conjugates (Alexa Fluor, FITC, TRITC, Rhodamine, Texas Red, R-PE, APC, Qdot Probes, Pacific Dyes, etc.).

Learn more

Documents

Contact us

  • Tel: (USA)
  • (UK)
  • Fax:
  • Email:

Submit A Review

Online Inquiry