Sign in or Register   Sign in or Register
  |  

Mouse Anti-P4HA2 Recombinant Antibody (CL0351) (CBMAB-P0612-YC)

Provided herein is a Mouse monoclonal antibody against Human Prolyl 4-Hydroxylase Subunit Alpha 2. The antibody can be used for immunoassay techniques, such as WB, IHC, IHC-P.
See all P4HA2 antibodies
Published Data
Fig.1 Normal breast duct (x20) shows faint cytoplasmic staining of P4HA2 in the normal epithelial cells. Occasional faint staining in the myoepithelial cells is also noticed.
...View More

Summary

Host Animal
Mouse
Specificity
Human
Clone
CL0351
Antibody Isotype
IgG1
Application
WB, IHC, IHC-P

Basic Information

Immunogen
A recombinant protein corresponding to amino acids: LKEYILVEEAKLSKIKSWANKMEALTSKSAADAEGYLAHPVNAYKLVKRLNTDWPALEDLVLQDSAAGFIANLSVQRQFFPTDEDEIGAAKALMRLQDTYRLDPGTISRGELPGTKYQAMLSVDDCFGM
Specificity
Human
Antibody Isotype
IgG1
Clonality
Monoclonal
Application Notes
The COA includes recommended starting dilutions, optimal dilutions should be determined by the end user.

Formulations & Storage [For reference only, actual COA shall prevail!]

Storage
Store at 4°C short term (1-2 weeks). Aliquot and store at-20°C long term. Avoid repeated freeze/thaw cycles.

Target

Full Name
Prolyl 4-Hydroxylase Subunit Alpha 2
Introduction
P4HA2 is a component of prolyl 4-hydroxylase, a key enzyme in collagen synthesis composed of two identical alpha subunits and two beta subunits. The encoded protein is one of several different types of alpha subunits and provides the major part of the catalytic site of the active enzyme. In collagen and related proteins, prolyl 4-hydroxylase catalyzes the formation of 4-hydroxyproline that is essential to the proper three-dimensional folding of newly synthesized procollagen chains. Alternatively spliced transcript variants encoding different isoforms have been described.
Entrez Gene ID
8974
UniProt ID
O15460
Alternative Names
Prolyl 4-Hydroxylase Subunit Alpha 2; Procollagen-Proline, 2-Oxoglutarate 4-Dioxygenase (Proline 4-Hydroxylase), Alpha Polypeptide II; Procollagen-Proline,2-Oxoglutarate-4-Dioxygenase Subunit Alpha-2; Prolyl 4-Hydroxylase, Alpha Polypeptide II; Collagen Prolyl 4-Hydroxylase Alpha(II); 4-PH Alpha 2;
Function
Catalyzes the post-translational formation of 4-hydroxyproline in -Xaa-Pro-Gly- sequences in collagens and other proteins.
Biological Process
Peptidyl-proline hydroxylation to 4-hydroxy-L-prolineManual Assertion Based On ExperimentIBA:GO_Central
Cellular Location
Endoplasmic reticulum lumen
Involvement in disease
Myopia 25, autosomal dominant (MYP25):
A refractive error of the eye, in which parallel rays from a distant object come to focus in front of the retina, vision being better for near objects than for far.

Zhang, J., Lyu, Z., Li, B., You, Z., Cui, N., Li, Y., ... & Ma, X. (2023). P4HA2 induces hepatic ductular reaction and biliary fibrosis in chronic cholestatic liver diseases. Hepatology, 78(1), 10-25.

Tolonen, J. P., Salo, A. M., Finnilä, M., Aro, E., Karjalainen, E., Ronkainen, V. P., ... & Myllyharju, J. (2022). Reduced Bone Mass in Collagen Prolyl 4 Hydroxylase P4ha1+/−; P4ha2−/− Compound Mutant Mice. Journal of Bone and Mineral Research Plus, 6(6), e10630.

Shang, L., Jiang, W., Zhang, J., & Wu, W. (2022). P4HA2 promotes occurrence and progression of liver cancer by regulating the PI3K/Akt/mTOR signaling pathway. Nan Fang yi ke da xue xue bao= Journal of Southern Medical University, 42(5), 665-672.

Aggarwal, V., Sahoo, S., Donnenberg, V. S., Chakraborty, P., Jolly, M. K., & Sant, S. (2022). P4HA2: A link between tumor-intrinsic hypoxia, partial EMT and collective migration. Advances in cancer biology-metastasis, 5, 100057.

Wu, Y., Zhang, X., Wang, J., Ji, R., Zhang, L., Qin, J., ... & Zhang, X. (2021). P4HA2 promotes cell proliferation and migration in glioblastoma. Oncology Letters, 22(2), 1-11.

Zhu, M., Peng, R., Liang, X., Lan, Z., Tang, M., Hou, P., ... & Wang, G. (2021). P4HA2-induced prolyl hydroxylation suppresses YAP1-mediated prostate cancer cell migration, invasion, and metastasis. Oncogene, 40(41), 6049-6056.

Lin, J., Jiang, L., Wang, X., Wei, W., Song, C., Cui, Y., ... & Qiu, G. (2021). P4HA2 promotes epithelial-to-mesenchymal transition and glioma malignancy through the collagen-dependent PI3K/AKT pathway. Journal of oncology, 2021, 1-14.

Cao, Y., Han, Q., Li, J., Jia, Y., Zhang, R., & Shi, H. (2020). P4HA2 contributes to cervical cancer progression via inducing epithelial-mesenchymal transition. Journal of Cancer, 11(10), 2788.

Zhang, T., Piao, H. Y., Guo, S., Zhao, Y., Wang, Y., Zheng, Z. C., & Zhang, J. (2020). LncRNA PCGEM1 enhances metastasis and gastric cancer invasion through targeting of miR-129-5p to regulate P4HA2 expression. Experimental and Molecular Pathology, 116, 104487.

Ask a question We look forward to hearing from you.
0 reviews or Q&As

Purchasing FAQs
Technical FAQs

Loading...
Have you used Mouse Anti-P4HA2 Recombinant Antibody (CL0351)?
Submit a review and get a Coupon or an Amazon gift card. 20% off Coupon $30 eGift Card
Submit a review
Loading...
For research use only. Not intended for any clinical use.

Custom Antibody Labeling

We also offer labeled antibodies developed using our catalog antibody products and nonfluorescent conjugates (HRP, AP, Biotin, etc.) or fluorescent conjugates (Alexa Fluor, FITC, TRITC, Rhodamine, Texas Red, R-PE, APC, Qdot Probes, Pacific Dyes, etc.).

Online Inquiry

Documents

Contact us

  • Tel: (USA)
  • (UK)
  • Fax:
  • Email:

Submit A Review

Go to
Compare