Mouse Anti-PTPN11 Recombinant Antibody (2E6) (CBMAB-BR411LY)

Go to compare Compare Online Inquiry
Request for COA
Datasheet Target Q & As Review & reward Protocols Associated Products

Basic Information

Host Animal
Mouse
Clone
2E6
Application
FC: 1-3 μg/1x10 cells, IF: 1:1000 dilution, IHC-P: 0.5-1 μg/ml, ICC: 1:200 dilution, WB: 0.1-0.5 μg/ml
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human SHP2 (69-99aa EKFATLAELVQYYMEHHGQLKEKNGDVIELK), identical to the related mouse and rat sequences.
Specificity
Human, Mouse, Rat
Antibody Isotype
IgG2b
Clonality
Monoclonal
Application Notes
The COA includes recommended starting dilutions, optimal dilutions should be determined by the end user.

Formulations & Storage [For reference only, actual COA shall prevail!]

Format
Lyophilized
Preservative
0.05 mg sodium azide
Storage
Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freezethaw cycles.
More Infomation

Target

Full Name
protein tyrosine phosphatase, non-receptor type 11
Entrez Gene ID
Human5781
Mouse19247
Rat25622
UniProt ID
HumanQ06124
MouseP35235
RatP41499
Alternative Names
Tyrosine-protein phosphatase non-receptor type 11; Protein-tyrosine phosphatase 1D; PTP-1D; Protein-tyrosine phosphatase 2C; PTP-2C; SH-PTP2; SHP-2; Shp2; SH-PTP3; PTPN11; PTP2C; SHPTP2
Function
Acts downstream of various receptor and cytoplasmic protein tyrosine kinases to participate in the signal transduction from the cell surface to the nucleus (PubMed:10655584, PubMed:18559669, PubMed:18829466, PubMed:26742426, PubMed:28074573).
Positively regulates MAPK signal transduction pathway (PubMed:28074573).
Dephosphorylates GAB1, ARHGAP35 and EGFR (PubMed:28074573).
Dephosphorylates ROCK2 at 'Tyr-722' resulting in stimulation of its RhoA binding activity (PubMed:18559669).
Dephosphorylates CDC73 (PubMed:26742426).
Dephosphorylates SOX9 on tyrosine residues, leading to inactivate SOX9 and promote ossification (By similarity).
Biological Process
Abortive mitotic cell cycleIEA:Ensembl
Atrioventricular canal developmentManual Assertion Based On ExperimentIMP:BHF-UCL
AxonogenesisIEA:Ensembl
Bergmann glial cell differentiationIEA:Ensembl
Brain developmentManual Assertion Based On ExperimentIMP:BHF-UCL
Cellular response to epidermal growth factor stimulusManual Assertion Based On ExperimentIMP:UniProtKB
Cerebellar cortex formationIEA:Ensembl
Cytokine-mediated signaling pathwayTAS:Reactome
DNA damage checkpoint signalingIEA:Ensembl
Ephrin receptor signaling pathwayManual Assertion Based On ExperimentIDA:UniProtKB
Epidermal growth factor receptor signaling pathwayTAS:Reactome
ERBB signaling pathwayManual Assertion Based On ExperimentIDA:UniProtKB
Face morphogenesisManual Assertion Based On ExperimentIMP:BHF-UCL
Fibroblast growth factor receptor signaling pathwayManual Assertion Based On ExperimentIMP:FlyBase
Genitalia developmentManual Assertion Based On ExperimentIMP:BHF-UCL
Glucose homeostasisIEA:Ensembl
Heart developmentManual Assertion Based On ExperimentIMP:BHF-UCL
Homeostasis of number of cells within a tissueIEA:Ensembl
Hormone metabolic processIEA:Ensembl
Hormone-mediated signaling pathwayIEA:Ensembl
Inner ear developmentManual Assertion Based On ExperimentIMP:BHF-UCL
Integrin-mediated signaling pathwayIEA:Ensembl
Intestinal epithelial cell migrationIEA:Ensembl
Megakaryocyte developmentIEA:Ensembl
Microvillus organizationIEA:Ensembl
Multicellular organism growthIEA:Ensembl
Multicellular organismal reproductive processIEA:Ensembl
Negative regulation of cell adhesion mediated by integrinIEA:Ensembl
Negative regulation of chondrocyte differentiationISS:UniProtKB
Negative regulation of cortisol secretionIEA:Ensembl
Negative regulation of growth hormone secretionIEA:Ensembl
Negative regulation of insulin secretionIEA:Ensembl
Neurotrophin TRK receptor signaling pathwayIEA:Ensembl
Organ growthIEA:Ensembl
Peptidyl-tyrosine dephosphorylationManual Assertion Based On ExperimentIDA:UniProtKB
Platelet formationIEA:Ensembl
Platelet-derived growth factor receptor signaling pathwayIEA:Ensembl
Positive regulation of ERK1 and ERK2 cascadeManual Assertion Based On ExperimentIMP:UniProtKB
Positive regulation of glucose importManual Assertion Based On ExperimentIDA:BHF-UCL
Positive regulation of hormone secretionIEA:Ensembl
Positive regulation of insulin receptor signaling pathwayManual Assertion Based On ExperimentIDA:BHF-UCL
Positive regulation of interferon-beta productionISS:ARUK-UCL
Positive regulation of interleukin-6 productionISS:ARUK-UCL
Positive regulation of mitotic cell cycleIEA:Ensembl
Positive regulation of ossificationISS:UniProtKB
Positive regulation of peptidyl-tyrosine phosphorylationManual Assertion Based On ExperimentIMP:ARUK-UCL
Positive regulation of tumor necrosis factor productionISS:ARUK-UCL
Protein dephosphorylationManual Assertion Based On ExperimentIMP:UniProtKB
Regulation of cell adhesion mediated by integrinManual Assertion Based On ExperimentIMP:UniProtKB
Regulation of protein export from nucleusIEA:Ensembl
Regulation of protein-containing complex assemblyManual Assertion Based On ExperimentIDA:BHF-UCL
Regulation of type I interferon-mediated signaling pathwayTAS:Reactome
T cell costimulationTAS:Reactome
Triglyceride metabolic processIEA:Ensembl
Cellular Location
Cytoplasm
Nucleus
Involvement in disease
LEOPARD syndrome 1 (LPRD1):
A disorder characterized by lentigines, electrocardiographic conduction abnormalities, ocular hypertelorism, pulmonic stenosis, abnormalities of genitalia, retardation of growth, and sensorineural deafness.
Noonan syndrome 1 (NS1):
A form of Noonan syndrome, a disease characterized by short stature, facial dysmorphic features such as hypertelorism, a downward eyeslant and low-set posteriorly rotated ears, and a high incidence of congenital heart defects and hypertrophic cardiomyopathy. Other features can include a short neck with webbing or redundancy of skin, deafness, motor delay, variable intellectual deficits, multiple skeletal defects, cryptorchidism, and bleeding diathesis. Individuals with Noonan syndrome are at risk of juvenile myelomonocytic leukemia, a myeloproliferative disorder characterized by excessive production of myelomonocytic cells. Some patients with NS1 develop multiple giant cell lesions of the jaw or other bony or soft tissues, which are classified as pigmented villonodular synovitis (PVNS) when occurring in the jaw or joints.
Leukemia, juvenile myelomonocytic (JMML):
An aggressive pediatric myelodysplastic syndrome/myeloproliferative disorder characterized by malignant transformation in the hematopoietic stem cell compartment with proliferation of differentiated progeny. Patients have splenomegaly, enlarged lymph nodes, rashes, and hemorrhages.
Metachondromatosis (MC):
A skeletal disorder with radiologic features of both multiple exostoses and Ollier disease, characterized by the presence of exostoses, commonly of the bones of the hands and feet, and enchondromas of the metaphyses of long bones and iliac crest.
PTM
Phosphorylated on Tyr-542 and Tyr-580 upon receptor protein tyrosine kinase activation; which creates a binding site for GRB2 and other SH2-containing proteins. Phosphorylated upon activation of the receptor-type kinase FLT3. Phosphorylated upon activation of the receptor-type kinase PDGFRA (By similarity).
Phosphorylated by activated PDGFRB.
Ask a question We look forward to hearing from you.
0 reviews or Q&As
Loading...
Have you used Mouse Anti-PTPN11 Recombinant Antibody (2E6)?
Submit a review and get a Coupon or an Amazon gift card. 20% off Coupon $30 eGift Card
Submit a review
Loading...
For research use only. Not intended for any clinical use.

Custom Antibody Labeling

We also offer labeled antibodies developed using our catalog antibody products and nonfluorescent conjugates (HRP, AP, Biotin, etc.) or fluorescent conjugates (Alexa Fluor, FITC, TRITC, Rhodamine, Texas Red, R-PE, APC, Qdot Probes, Pacific Dyes, etc.).

Online Inquiry

Contact us

  • Tel: (USA)
  • (UK)
  • Fax:
  • Email:

Submit A Review

online inquiry
Online Inquiry
Happy Holidays
Happy Holidays close ad