Mouse Anti-RBCK1 Recombinant Antibody (CBCNR-293) (CBMAB-R1679-CN)

Go to compare Compare Online Inquiry
Request for COA
Datasheet Target Q & As Review & reward Protocols Associated Products

Basic Information

Host Animal
Mouse
Clone
CBCNR-293
Application
WB, IHC-P
Immunogen
A recombinant protein corresponding to the following amino acids sequence: SVEDAQMHTVTIWLTVRPDMTVASLKDMVFLDYGFPPVLQQWVIGQRLARDQETLHSHGVRQNGDSAYLYLLSARNTSLNPQELQRERQLRMLEDLGFKDLTLQPRGPLEPGPPKPGVPQEPGRGQPDAVPEP
Specificity
Human
Antibody Isotype
IgG1
Clonality
Monoclonal
Application Notes
The COA includes recommended starting dilutions, optimal dilutions should be determined by the end user.
More Infomation

Target

Full Name
RanBP-type and C3HC4-type zinc finger containing 1
Introduction
The protein encoded by this gene is similar to mouse UIP28/UbcM4 interacting protein. Alternative splicing has been observed at this locus, resulting in distinct isoforms. [provided by RefSeq, Jul 2008]
Entrez Gene ID
UniProt ID
Alternative Names
RANBP2-Type And C3HC4-Type Zinc Finger Containing 1; Heme-Oxidized IRP2 Ubiquitin Ligase 1; RING-Type E3 Ubiquitin Transferase HOIL-1; Hepatitis B Virus X-Associated Protein 4; HBV-Associated Factor 4; RING Finger Protein 54; C20orf18; UBCE7IP3; HOIL-1; RNF54; XAP3; XAP4; RanBP-Type And C3HC4-Type Zinc Finger-Containing Protein 1;
Function
E3 ubiquitin-protein ligase, which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes, such as UBE2L3/UBCM4, and then transfers it to substrates (PubMed:12629548, PubMed:17449468, PubMed:18711448).
Functions as an E3 ligase for oxidized IREB2 and both heme and oxygen are necessary for IREB2 ubiquitination (PubMed:12629548).
Promotes ubiquitination of TAB2 and IRF3 and their degradation by the proteasome (PubMed:17449468, PubMed:18711448).
Component of the LUBAC complex which conjugates linear ('Met-1'-linked) polyubiquitin chains to substrates and plays a key role in NF-kappa-B activation and regulation of inflammation (PubMed:17006537, PubMed:21455173, PubMed:21455180, PubMed:21455181, PubMed:19136968).
LUBAC conjugates linear polyubiquitin to IKBKG and RIPK1 and is involved in activation of the canonical NF-kappa-B and the JNK signaling pathways (PubMed:17006537, PubMed:21455173, PubMed:21455180, PubMed:21455181, PubMed:19136968).
Linear ubiquitination mediated by the LUBAC complex interferes with TNF-induced cell death and thereby prevents inflammation (PubMed:17006537, PubMed:21455173, PubMed:21455180, PubMed:21455181).
LUBAC is recruited to the TNF-R1 signaling complex (TNF-RSC) following polyubiquitination of TNF-RSC components by BIRC2 and/or BIRC3 and to conjugate linear polyubiquitin to IKBKG and possibly other components contributing to the stability of the complex (PubMed:17006537, PubMed:21455173, PubMed:21455180, PubMed:21455181, PubMed:19136968).
The LUBAC complex is also involved in innate immunity by conjugating linear polyubiquitin chains at the surface of bacteria invading the cytosol to form the ubiquitin coat surrounding bacteria (PubMed:28481331).
LUBAC is not able to initiate formation of the bacterial ubiquitin coat, and can only promote formation of linear polyubiquitins on pre-existing ubiquitin (PubMed:28481331).
The bacterial ubiquitin coat acts as an 'eat-me' signal for xenophagy and promotes NF-kappa-B activation (PubMed:28481331).
Together with OTULIN, the LUBAC complex regulates the canonical Wnt signaling during angiogenesis (PubMed:23708998).
Binds polyubiquitin of different linkage types (PubMed:20005846, PubMed:21455181).
Biological Process
Biological Process cytoplasmic sequestering of proteinIDA:GO_Central
Biological Process defense response to bacteriumManual Assertion Based On ExperimentIMP:UniProtKB
Biological Process negative regulation of necroptotic processIEA:Ensembl
Biological Process negative regulation of NF-kappaB transcription factor activityManual Assertion Based On ExperimentIDA:UniProtKB
Biological Process positive regulation of extrinsic apoptotic signaling pathwayIEA:Ensembl
Biological Process positive regulation of I-kappaB kinase/NF-kappaB signalingManual Assertion Based On ExperimentIDA:UniProtKB
Biological Process positive regulation of NF-kappaB transcription factor activityManual Assertion Based On ExperimentIDA:UniProtKB
Biological Process positive regulation of NIK/NF-kappaB signalingIEA:Ensembl
Biological Process proteasome-mediated ubiquitin-dependent protein catabolic processManual Assertion Based On ExperimentIMP:UniProtKB
Biological Process protein linear polyubiquitinationManual Assertion Based On ExperimentIDA:UniProtKB
Biological Process protein polyubiquitinationManual Assertion Based On ExperimentIDA:UniProtKB
Biological Process T cell receptor signaling pathwayManual Assertion Based On ExperimentIDA:UniProtKB
Cellular Location
cytosol
LUBAC complex
ubiquitin ligase complex
Involvement in disease
Polyglucosan body myopathy 1 with or without immunodeficiency (PGBM1):
A disease characterized by polyglucosan storage myopathy associated with early-onset progressive muscle weakness and progressive dilated cardiomyopathy, which may necessitate cardiac transplant in severe cases. Some patients present with severe immunodeficiency, invasive bacterial infections and chronic autoinflammation.
PTM
Auto-ubiquitinated. Auto-ubiquitination leads to degradation by the proteasome (By similarity).
Phosphorylated. In vitro, phosphorylation inhibits auto-ubiquitination activity (By similarity).
Ask a question We look forward to hearing from you.
0 reviews or Q&As
Loading...
Have you used Mouse Anti-RBCK1 Recombinant Antibody (CBCNR-293)?
Submit a review and get a Coupon or an Amazon gift card. 20% off Coupon $30 eGift Card
Submit a review
Loading...
For research use only. Not intended for any clinical use.

Custom Antibody Labeling

We also offer labeled antibodies developed using our catalog antibody products and nonfluorescent conjugates (HRP, AP, Biotin, etc.) or fluorescent conjugates (Alexa Fluor, FITC, TRITC, Rhodamine, Texas Red, R-PE, APC, Qdot Probes, Pacific Dyes, etc.).

Online Inquiry

Contact us

  • Tel: (USA)
  • (UK)
  • Fax:
  • Email:

Submit A Review

online inquiry
Online Inquiry
Happy Holidays
Happy Holidays close ad