Mouse Anti-SLC22A2 Recombinant Antibody (CL0631) (CBMAB-0845CQ)

Go to compare Compare Online Inquiry
Request for COA
Datasheet Target Q & As Review & reward Protocols Associated Products

Basic Information

Host Animal
Mouse
Clone
CL0631
Application
IHC, IHC-P
Immunogen
Recombinant protein between: ESPRWLISQNKNAEAMRIIKHIAKKNGKSLPASLQRLRLEEETGKKLNPSFLDLVRTPQIR
Specificity
Human
Antibody Isotype
IgG2b
Clonality
Monoclonal
Application Notes
The COA includes recommended starting dilutions, optimal dilutions should be determined by the end user.

Formulations & Storage [For reference only, actual COA shall prevail!]

Purity
>95% as determined by analysis by SDS-PAGE
Storage
Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze/thaw cycles.
More Infomation

Target

Full Name
solute carrier family 22 (organic cation transporter), member 2
Introduction
Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. Mediates tubular uptake of organic compounds from circulation. Mediates the influx of agmatine, dopamine, noradrenaline (norepinephrine), serotonin, choline, famotidine, ranitidine, histamin, creatinine, amantadine, memantine, acriflavine, 4-[4-(dimethylamino)-styryl]-N-methylpyridinium ASP, amiloride, metformin, N-1-methylnicotinamide (NMN), tetraethylammonium (TEA), 1-methyl-4-phenylpyridinium (MPP), cimetidine, cisplatin and oxaliplatin. Cisplatin may develop a nephrotoxic action. Transport of creatinine is inhibited by fluoroquinolones such as DX-619 and LVFX. This transporter is a major determinant of the anticancer activity of oxaliplatin and may contribute to antitumor specificity.
Entrez Gene ID
UniProt ID
Alternative Names
OCT2
Function
Mediates tubular uptake of organic compounds from circulation. Mediates the transport of prostaglandin E2 (PGE2) and prostaglandin F2-alpha (PGF2-alpha) and may be involved in their renal excretion (PubMed:11907186).
Mediates the influx of agmatine, dopamine, noradrenaline (norepinephrine), serotonin, choline, famotidine, ranitidine, histamine, creatinine, amantadine, memantine, acriflavine, 4-[4-(dimethylamino)-styryl]-N-methylpyridinium ASP, amiloride, metformin, N-1-methylnicotinamide (NMN), tetraethylammonium (TEA), 1-methyl-4-phenylpyridinium (MPP), cimetidine, cisplatin and oxaliplatin. Cisplatin may develop a nephrotoxic action. Transport of creatinine is inhibited by fluoroquinolones such as DX-619 and LVFX. This transporter is a major determinant of the anticancer activity of oxaliplatin and may contribute to antitumor specificity.
Biological Process
Biological Process activation of cysteine-type endopeptidase activity involved in apoptotic processISS:ARUK-UCL
Biological Process amine transportManual Assertion Based On ExperimentIDA:ARUK-UCL
Biological Process amino acid import across plasma membraneManual Assertion Based On ExperimentIMP:ARUK-UCL
Biological Process body fluid secretionManual Assertion Based On ExperimentTAS:ProtInc
Biological Process choline transportManual Assertion Based On ExperimentIDA:ARUK-UCL
Biological Process dopamine uptakeManual Assertion Based On ExperimentIDA:ARUK-UCL
Biological Process export across plasma membraneManual Assertion Based On ExperimentIDA:ARUK-UCL
Biological Process histamine uptakeManual Assertion Based On ExperimentIDA:ARUK-UCL
Biological Process L-alpha-amino acid transmembrane transportManual Assertion Based On ExperimentIMP:ARUK-UCL
Biological Process L-arginine import across plasma membraneManual Assertion Based On ExperimentIMP:ARUK-UCL
Biological Process neurotransmitter transportManual Assertion Based On ExperimentIDA:ARUK-UCL
Biological Process norepinephrine uptakeManual Assertion Based On ExperimentIDA:ARUK-UCL
Biological Process organic cation transportManual Assertion Based On ExperimentIDA:ARUK-UCL
Biological Process positive regulation of gene expressionISS:ARUK-UCL
Biological Process purine-containing compound transmembrane transportTAS:Reactome
Biological Process serotonin uptakeManual Assertion Based On ExperimentIDA:ARUK-UCL
Biological Process toxin transportManual Assertion Based On ExperimentIDA:ARUK-UCL
Biological Process transport across blood-brain barrier2 PublicationsNAS:ARUK-UCL
Biological Process xenobiotic transportManual Assertion Based On ExperimentIDA:ARUK-UCL
Biological Process xenobiotic transport across blood-brain barrier1 PublicationNAS:ARUK-UCL
Cellular Location
Membrane
Ask a question We look forward to hearing from you.
0 reviews or Q&As
Loading...
Have you used Mouse Anti-SLC22A2 Recombinant Antibody (CL0631)?
Submit a review and get a Coupon or an Amazon gift card. 20% off Coupon $30 eGift Card
Submit a review
Loading...
For research use only. Not intended for any clinical use.

Custom Antibody Labeling

We also offer labeled antibodies developed using our catalog antibody products and nonfluorescent conjugates (HRP, AP, Biotin, etc.) or fluorescent conjugates (Alexa Fluor, FITC, TRITC, Rhodamine, Texas Red, R-PE, APC, Qdot Probes, Pacific Dyes, etc.).

Online Inquiry

Contact us

  • Tel: (USA)
  • (UK)
  • Fax:
  • Email:

Submit A Review

online inquiry
Online Inquiry