Search :
Sign in or Register  
Welcome Sign in or Don't have an account?Register

Mouse Anti-TAF4 Recombinant Antibody (CBYJT-1870) (CBMAB-T0939-YJ)

Online Inquiry

Summary

Host Animal
Mouse
Specificity
Human
Clone
CBYJT-1870
Antibody Isotype
IgG
Application
Dot, WB

Basic Information

Immunogen
Partial sequence of recombinant full-length protein to human TAF4 RNA Polymerase II, TATA Box Binding Protein (TBP)-associated Factor corresponding to amino acids within the C-terminal portion of the protein. Immunogen sequence: ETAQQKNFSYKDDDRYEQASDVRAQLKFFEQLDQIEKQRKDEQEREILMRAAKSRSRQEDPEQLRLKQKAKEMQQQELAQMRQRDANLTALAAIGPRKKRKVDCPGPGSGAEGSGPGSVVPGSSGVGTPRQFT
Specificity
Human
Antibody Isotype
IgG
Clonality
Monoclonal
Application Notes
The COA includes recommended starting dilutions, optimal dilutions should be determined by the end user.

Formulations & Storage [For reference only, actual COA shall prevail!]

Buffer
PBS, 1% BSA
Preservative
0.05% Sodium Azide
Storage
Store at 4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze/thaw cycles.
Epitope
C-terminus

Target

Full Name
TATA-Box Binding Protein Associated Factor 4
Introduction
Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. TAF4 is one of the larger subunits of TFIID that has been shown to potentiate transcriptional activation by retinoic acid, thyroid hormone and vitamin D3 receptors. In addition, TAF4 interacts with the transcription factor CREB, which has a glutamine-rich activation domain, and binds to other proteins containing glutamine-rich regions.
Entrez Gene ID
UniProt ID
Alternative Names
TATA-Box Binding Protein Associated Factor 4; TAF4 RNA Polymerase II, TATA Box Binding Protein (TBP)-Associated Factor, 135kDa; TATA Box Binding Protein (TBP)-Associated Factor, RNA Polymerase II, C1, 130kD; Transcription Initiation Factor TFIID 130 KDa Subunit; Transcription Initiation Factor TFIID 135 KDa Subunit; RNA Polymerase II TBP-Associated Factor Subunit C; TBP-Associated Factor 4; TAF(II)130; TAF(II)135; TAFII-130
Function
The TFIID basal transcription factor complex plays a major role in the initiation of RNA polymerase II (Pol II)-dependent transcription (PubMed:33795473).
TFIID recognizes and binds promoters with or without a TATA box via its subunit TBP, a TATA-box-binding protein, and promotes assembly of the pre-initiation complex (PIC) (PubMed:33795473).
The TFIID complex consists of TBP and TBP-associated factors (TAFs), including TAF1, TAF2, TAF3, TAF4, TAF5, TAF6, TAF7, TAF8, TAF9, TAF10, TAF11, TAF12 and TAF13 (PubMed:33795473, PubMed:10594036, PubMed:8942982).
TAF4 may maintain an association between the TFIID and TFIIA complexes, while bound to the promoter, together with TBP, during PIC assembly (PubMed:33795473).
Potentiates transcriptional activation by the AF-2S of the retinoic acid, vitamin D3 and thyroid hormone (PubMed:9192867).
Biological Process
Biological Process DNA-templated transcription initiationIDA:UniProtKB1 Publication
Biological Process histone H3 acetylationIDA:ComplexPortal1 Publication
Biological Process monoubiquitinated histone deubiquitinationIDA:ComplexPortal1 Publication
Biological Process monoubiquitinated histone H2A deubiquitinationIDA:ComplexPortal1 Publication
Biological Process mRNA transcription by RNA polymerase IIIDA:ComplexPortal1 Publication
Biological Process ovarian follicle developmentIEA:Ensembl
Biological Process positive regulation of DNA-templated transcriptionIC:ComplexPortal1 Publication
Biological Process positive regulation of transcription initiation by RNA polymerase IIIDA:ComplexPortal1 Publication
Biological Process protein phosphorylationIDA:ComplexPortal1 Publication
Biological Process regulation of DNA repairIC:ComplexPortal1 Publication
Biological Process regulation of transcription by RNA polymerase IIIDA:ComplexPortal1 Publication
Biological Process RNA polymerase II preinitiation complex assemblyIPI:ComplexPortal1 Publication
Biological Process transcription by RNA polymerase IITAS:ProtInc1 Publication
Biological Process transcription initiation at RNA polymerase II promoterIDA:UniProtKB2 Publications
Cellular Location
Nucleus
More Infomation
Ask a question We look forward to hearing from you.
0 reviews or Q&As
Loading...
Have you used Mouse Anti-TAF4 Recombinant Antibody (CBYJT-1870)?
Submit a review and get a Coupon or an Amazon gift card. 20% off Coupon $30 eGift Card
Submit a review
Loading...
For research use only. Not intended for any clinical use.

Custom Antibody Labeling

We also offer labeled antibodies developed using our catalog antibody products and nonfluorescent conjugates (HRP, AP, Biotin, etc.) or fluorescent conjugates (Alexa Fluor, FITC, TRITC, Rhodamine, Texas Red, R-PE, APC, Qdot Probes, Pacific Dyes, etc.).

Learn more

Documents

Online Inquiry