Sign in or Register   Sign in or Register
  |  

Mouse Anti-WWTR1 Recombinant Antibody (CBYJT-5584) (CBMAB-T5217-YJ)

Provided herein is a Mouse monoclonal antibody, which binds to WWTR1 (WW Domain Containing Transcription Regulator 1). The antibody can be used for immunoassay techniques, such as WB.
See all WWTR1 antibodies

Summary

Host Animal
Mouse
Specificity
Human
Clone
CBYJT-5584
Antibody Isotype
IgG1
Application
WB

Basic Information

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: MNPKPSSWRKKILPESFFKEPDSGSHSRQSSTDSSGGHPGPRLAGGAQHVRSHSSPASLQLGTGAGAAGSPAQQHAHLRQQSYDVTDELPLPPGWEMTFTATGQRYFLNHIEKITTWQDPRKAMNQPLNHMNLHPAVSST
Specificity
Human
Antibody Isotype
IgG1
Clonality
Monoclonal
Application Notes
The COA includes recommended starting dilutions, optimal dilutions should be determined by the end user.

Formulations & Storage [For reference only, actual COA shall prevail!]

Buffer
PBS, pH 7.4
Storage
Store at 4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze/thaw cycles.

Target

Full Name
WW domain containing transcription regulator 1
Introduction
WWTR1 is a transcriptional coactivator which acts as a downstream regulatory target in the Hippo signaling pathway that plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein STK3/MST2 and STK4/MST1, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. WWTR1 enhances PAX8 and NKX2-1/TTF1-dependent gene activation. It regulates the nuclear accumulation of SMADS and has a key role in coupling them to the transcriptional machinery such as the mediator complex. It regulates embryonic stem-cell self-renewal, promotes cell proliferation and epithelial-mesenchymal transition.
Entrez Gene ID
UniProt ID
Alternative Names
WW Domain Containing Transcription Regulator 1; TAZ; WW Domain-Containing Transcription Regulator Protein 1; Transcriptional Co-Activator With PDZ-Binding Motif; Transcriptional Coactivator With PDZ-Binding Motif
Function
Transcriptional coactivator which acts as a downstream regulatory target in the Hippo signaling pathway that plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis (PubMed:11118213, PubMed:18227151).
The core of this pathway is composed of a kinase cascade wherein STK3/MST2 and STK4/MST1, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ (PubMed:18227151).
WWTR1 enhances PAX8 and NKX2-1/TTF1-dependent gene activation (PubMed:19010321).
In conjunction with YAP1, involved in the regulation of TGFB1-dependent SMAD2 and SMAD3 nuclear accumulation (PubMed:18568018).
Plays a key role in coupling SMADs to the transcriptional machinery such as the mediator complex (PubMed:18568018).
Regulates embryonic stem-cell self-renewal, promotes cell proliferation and epithelial-mesenchymal transition (PubMed:18227151, PubMed:18568018).
Biological Process
Biological Process cilium assembly Source:Ensembl
Biological Process glomerulus development Source:Ensembl
Biological Process heart process Source:Ensembl
Biological Process hippo signaling Source:UniProtKB1 Publication
Biological Process kidney morphogenesis Source:Ensembl
Biological Process mesenchymal cell differentiation Source:Ensembl
Biological Process multicellular organism growth Source:Ensembl
Biological Process negative regulation of canonical Wnt signaling pathway Source:BHF-UCL1 Publication
Biological Process negative regulation of fat cell differentiation Source:ARUK-UCL1 Publication
Biological Process negative regulation of protein kinase activity Source:BHF-UCL1 Publication
Biological Process negative regulation of protein phosphorylation Source:BHF-UCL1 Publication
Biological Process negative regulation of transcription by RNA polymerase II Source:Ensembl
Biological Process osteoblast differentiation Source:Ensembl
Biological Process positive regulation of cell population proliferation Source:UniProtKB1 Publication
Biological Process positive regulation of epithelial to mesenchymal transition Source:UniProtKB1 Publication
Biological Process positive regulation of osteoblast differentiation Source:ARUK-UCL1 Publication
Biological Process positive regulation of protein localization to nucleus Source:UniProtKB
Biological Process positive regulation of transcription by RNA polymerase II Source:GO_Central1 Publication
Biological Process protein ubiquitination Source:Ensembl
Biological Process regulation of DNA-templated transcription Source:UniProtKB1 Publication
Biological Process regulation of metanephric nephron tubule epithelial cell differentiation Source:Ensembl
Biological Process regulation of SMAD protein signal transduction Source:UniProtKB1 Publication
Biological Process SCF-dependent proteasomal ubiquitin-dependent protein catabolic process Source:Ensembl
Biological Process stem cell division Source:UniProtKB1 Publication
Biological Process tissue homeostasis Source:Ensembl
Cellular Location
Nucleus
Cytoplasm
Cell membrane
Concentrates along specific portions of the plasma membrane, and accumulates in punctate nuclear bodies (By similarity).
When phosphorylated, is retained in the cytoplasm by YWHAZ (By similarity).
Can be retained in the nucleus by MED15 (PubMed:18568018).
Localized in the cytoplasm in areas of epithelial cell high density (PubMed:21145499).
At blastocyst stage expressed in the nucleus in trophectodermal cells, however expressed in the cytoplasm in the inner cell mass (By similarity).
PTM
Phosphorylated by LATS2 and STK3/MST2. Phosphorylation by LATS2 results in creation of 14-3-3 binding sites, retention in the cytoplasm, and functional inactivation. Phosphorylation results in the inhibition of transcriptional coactivation through YWHAZ-mediated nuclear export.
Ask a question We look forward to hearing from you.
0 reviews or Q&As
Loading...
Have you used Mouse Anti-WWTR1 Recombinant Antibody (CBYJT-5584)?
Submit a review and get a Coupon or an Amazon gift card. 20% off Coupon $30 eGift Card
Submit a review
Loading...
For research use only. Not intended for any clinical use.

Custom Antibody Labeling

We also offer labeled antibodies developed using our catalog antibody products and nonfluorescent conjugates (HRP, AP, Biotin, etc.) or fluorescent conjugates (Alexa Fluor, FITC, TRITC, Rhodamine, Texas Red, R-PE, APC, Qdot Probes, Pacific Dyes, etc.).

Online Inquiry

Documents

Contact us

  • Tel: (USA)
  • (UK)
  • Fax:
  • Email:

Submit A Review

Go to
Compare