Mouse Anti-ZFP36 Recombinant Antibody (CBYJT-5611) (CBMAB-T5244-YJ)

Go to compare Compare Online Inquiry
Request for COA
Datasheet Target Q & As Review & reward Protocols Associated Products

Basic Information

Host Animal
Mouse
Clone
CBYJT-5611
Application
WB, IHC-P, FC
Immunogen
Recombinant full length protein corresponding to Human Tristetraprolin aa 1-332. Produced in HEK-293T cells. Sequence: MANRYTMDLTAIYESLLSLSPDVPVPSDHGGTESSPGWGSSGPWSLSPSD SSPSGVTSRLPGRSTSLVEGRSCGWVPPPPGFAPLAPRLGPELSPSPTSP TATSTTPSRYKTELCRTFSESGRCRYGAKCQFAHGLGELRQANRHPKYKT ELCHKFYLQGRCPYGSRCHFIHNPSEDLAAPGHPPVLRQSISFSGLPSGR RTSPPPPGLAGPSLSSSSFSPSSSPPPPGDLPLSPSAFSAAPGTPLARRD PTPVCCPSCRRATPISVWGPLGGLVRTPSVQSLGSDPDEYASSGSSLGGS DSPVFEAGVFAPPQPVAAPRRLPIFNRISVSE
Specificity
Human
Antibody Isotype
IgG2a
Clonality
Monoclonal
Application Notes
The COA includes recommended starting dilutions, optimal dilutions should be determined by the end user.

Formulations & Storage [For reference only, actual COA shall prevail!]

Buffer
PBS, pH 7.4
Storage
Store at 4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze/thaw cycles.
Epitope
aa 1-332
More Infomation

Target

Full Name
ZFP36 Ring Finger Protein
Introduction
ZFP36 is a Zinc-finger RNA-binding protein that destabilizes several cytoplasmic AU-rich element (ARE)-containing mRNA transcripts by promoting their poly(A) tail removal or deadenylation, and hence provide a mechanism for attenuating protein synthesis (PubMed:9703499, PubMed:10330172, PubMed:10751406, PubMed:11279239, PubMed:12115244, PubMed:12748283, PubMed:15187101, PubMed:15634918, PubMed:17030620, PubMed:16702957, PubMed:20702587, PubMed:20221403, PubMed:21775632, PubMed:27193233, PubMed:23644599, PubMed:25815583). ZFP36 acts as an 3-untranslated region (UTR) ARE mRNA-binding adapter protein to communicate signaling events to the mRNA decay machinery (PubMed:15687258, PubMed:23644599). It recruits deadenylase CNOT7 (and probably the CCR4-NOT complex) via association with CNOT1, and hence promotes ARE-mediated mRNA deadenylation (PubMed:23644599). Functions also by recruiting components of the cytoplasmic RNA decay machinery to the bound ARE-containing mRNAs (PubMed:11719186, PubMed:12748283, PubMed:15687258, PubMed:16364915). Self regulates by destabilizing its own mRNA (PubMed:15187101). It binds to 3-UTR ARE of numerous mRNAs and of its own mRNA (PubMed:10330172, PubMed:10751406, PubMed:12115244, PubMed:15187101, PubMed:15634918, PubMed:17030620, PubMed:16702957, PubMed:19188452, PubMed:20702587, PubMed:20221403, PubMed:21775632, PubMed:25815583). It plays a role in anti-inflammatory responses; suppresses tumor necrosis factor (TNF)-alpha production by stimulating ARE-mediated TNF-alpha mRNA decay and several other inflammatory ARE-containing mRNAs in interferon (IFN)- and/or lipopolysaccharide (LPS)-induced macrophages (By similarity). It plays also a role in the regulation of dendritic cell maturation at the post-transcriptional level, and hence operates as part of a negative feedback loop to limit the inflammatory response (PubMed:18367721). It promotes ARE-mediated mRNA decay of hypoxia-inducible factor HIF1A mRNA during the response of endothelial cells to hypoxia (PubMed:21775632). Positively regulates early adipogenesis of preadipocytes by promoting ARE-mediated mRNA decay of immediate early genes (IEGs) (By similarity). ZFP36 negatively regulates hematopoietic/erythroid cell differentiation by promoting ARE-mediated mRNA decay of the transcription factor STAT5B mRNA (PubMed:20702587). It plays a role in maintaining skeletal muscle satellite cell quiescence by promoting ARE-mediated mRNA decay of the myogenic determination factor MYOD1 mRNA (By similarity). ZFP36 associates also with and regulates the expression of non-ARE-containing target mRNAs at the post-transcriptional level, such as MHC class I mRNAs (PubMed:18367721). It participates in association with argonaute RISC catalytic components in the ARE-mediated mRNA decay mechanism; assists microRNA (miRNA) targeting ARE-containing mRNAs (PubMed:15766526). It may also function in the regulation of cytoplasmic mRNA decapping; enhances decapping of ARE-containing RNAs, in vitro (PubMed:16364915). It is Involved in the delivery of target ARE-mRNAs to processing bodies (PBs) (PubMed:17369404). In addition to its cytosolic mRNA-decay function, affects nuclear pre-mRNA processing (By similarity). ZFP36 negatively regulates nuclear poly(A)-binding protein PABPN1-stimulated polyadenylation activity on ARE-containing pre-mRNA during LPS-stimulated macrophages (By similarity). It is also involved in the regulation of stress granule (SG) and P-body (PB) formation and fusion (By similarity). It plays a role in the regulation of keratinocyte proliferation, differentiation and apoptosis (PubMed:27182009). It functions as a tumor suppressor by inhibiting cell proliferation in breast cancer cells (PubMed:26926077).
Entrez Gene ID
UniProt ID
Alternative Names
TTP; G0S24; GOS24; TIS11; NUP475; zfp-36; RNF162A
Function
Zinc-finger RNA-binding protein that destabilizes several cytoplasmic AU-rich element (ARE)-containing mRNA transcripts by promoting their poly(A) tail removal or deadenylation, and hence provide a mechanism for attenuating protein synthesis (PubMed:9703499, PubMed:10330172, PubMed:10751406, PubMed:11279239, PubMed:12115244, PubMed:12748283, PubMed:15187101, PubMed:15634918, PubMed:17030620, PubMed:16702957, PubMed:20702587, PubMed:20221403, PubMed:21775632, PubMed:27193233, PubMed:23644599, PubMed:25815583, PubMed:31439631).
Acts as an 3'-untranslated region (UTR) ARE mRNA-binding adapter protein to communicate signaling events to the mRNA decay machinery (PubMed:15687258, PubMed:23644599).
Recruits deadenylase CNOT7 (and probably the CCR4-NOT complex) via association with CNOT1, and hence promotes ARE-mediated mRNA deadenylation (PubMed:23644599).
Functions also by recruiting components of the cytoplasmic RNA decay machinery to the bound ARE-containing mRNAs (PubMed:11719186, PubMed:12748283, PubMed:15687258, PubMed:16364915).
Self regulates by destabilizing its own mRNA (PubMed:15187101).
Binds to 3'-UTR ARE of numerous mRNAs and of its own mRNA (PubMed:10330172, PubMed:10751406, PubMed:12115244, PubMed:15187101, PubMed:15634918, PubMed:17030620, PubMed:16702957, PubMed:19188452, PubMed:20702587, PubMed:20221403, PubMed:21775632, PubMed:25815583).
Plays a role in anti-inflammatory responses; suppresses tumor necrosis factor (TNF)-alpha production by stimulating ARE-mediated TNF-alpha mRNA decay and several other inflammatory ARE-containing mRNAs in interferon (IFN)- and/or lipopolysaccharide (LPS)-induced macrophages (By similarity).
Also plays a role in the regulation of dendritic cell maturation at the post-transcriptional level, and hence operates as part of a negative feedback loop to limit the inflammatory response (PubMed:18367721).
Promotes ARE-mediated mRNA decay of hypoxia-inducible factor HIF1A mRNA during the response of endothelial cells to hypoxia (PubMed:21775632).
Positively regulates early adipogenesis of preadipocytes by promoting ARE-mediated mRNA decay of immediate early genes (IEGs) (By similarity).
Negatively regulates hematopoietic/erythroid cell differentiation by promoting ARE-mediated mRNA decay of the transcription factor STAT5B mRNA (PubMed:20702587).
Plays a role in maintaining skeletal muscle satellite cell quiescence by promoting ARE-mediated mRNA decay of the myogenic determination factor MYOD1 mRNA (By similarity).
Associates also with and regulates the expression of non-ARE-containing target mRNAs at the post-transcriptional level, such as MHC class I mRNAs (PubMed:18367721).
Participates in association with argonaute RISC catalytic components in the ARE-mediated mRNA decay mechanism; assists microRNA (miRNA) targeting ARE-containing mRNAs (PubMed:15766526).
May also play a role in the regulation of cytoplasmic mRNA decapping; enhances decapping of ARE-containing RNAs, in vitro (PubMed:16364915).
Involved in the delivery of target ARE-mRNAs to processing bodies (PBs) (PubMed:17369404).
In addition to its cytosolic mRNA-decay function, affects nuclear pre-mRNA processing (By similarity).
Negatively regulates nuclear poly(A)-binding protein PABPN1-stimulated polyadenylation activity on ARE-containing pre-mRNA during LPS-stimulated macrophages (By similarity).
Also involved in the regulation of stress granule (SG) and P-body (PB) formation and fusion (By similarity).
Plays a role in the regulation of keratinocyte proliferation, differentiation and apoptosis (PubMed:27182009).
Plays a role as a tumor suppressor by inhibiting cell proliferation in breast cancer cells (PubMed:26926077).
Biological Process
Biological Process 3'-UTR-mediated mRNA destabilization Source:UniProtKB5 Publications
Biological Process 3'-UTR-mediated mRNA stabilization Source:UniProtKB1 Publication
Biological Process cellular response to epidermal growth factor stimulus Source:UniProtKB1 Publication
Biological Process cellular response to fibroblast growth factor stimulus Source:UniProtKB1 Publication
Biological Process cellular response to glucocorticoid stimulus Source:UniProtKB1 Publication
Biological Process cellular response to granulocyte macrophage colony-stimulating factor stimulus Source:UniProtKB1 Publication
Biological Process cellular response to lipopolysaccharide Source:UniProtKB1 Publication
Biological Process cellular response to tumor necrosis factor Source:UniProtKB1 Publication
Biological Process hematopoietic stem cell differentiation Source:Ensembl
Biological Process MAPK cascade Source:UniProtKB1 Publication
Biological Process miRNA-mediated gene silencing by inhibition of translation Source:UniProtKB
Biological Process mRNA catabolic process Source:UniProtKB2 Publications
Biological Process mRNA transport Source:UniProtKB1 Publication
Biological Process myeloid cell differentiation Source:Ensembl
Biological Process negative regulation of erythrocyte differentiation Source:UniProtKB1 Publication
Biological Process negative regulation of hematopoietic stem cell differentiation Source:Ensembl
Biological Process negative regulation of inflammatory response Source:Ensembl
Biological Process negative regulation of interleukin-2 production Source:UniProtKB
Biological Process negative regulation of polynucleotide adenylyltransferase activity Source:UniProtKB
Biological Process negative regulation of transcription by RNA polymerase II Source:UniProtKB1 Publication
Biological Process negative regulation of viral transcription Source:UniProtKB1 Publication
Biological Process nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay Source:UniProtKB1 Publication
Biological Process nuclear-transcribed mRNA catabolic process, deadenylation-independent decay Source:UniProtKB1 Publication
Biological Process nuclear-transcribed mRNA poly(A) tail shortening Source:BHF-UCL1 Publication
Biological Process p38MAPK cascade Source:UniProtKB
Biological Process positive regulation of deadenylation-independent decapping of nuclear-transcribed mRNA Source:UniProtKB1 Publication
Biological Process positive regulation of fat cell differentiation Source:UniProtKB
Biological Process positive regulation of intracellular mRNA localization Source:UniProtKB1 Publication
Biological Process positive regulation of miRNA-mediated gene silencing Source:UniProtKB1 Publication
Biological Process positive regulation of nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay Source:UniProtKB1 Publication
Biological Process positive regulation of nuclear-transcribed mRNA poly(A) tail shortening Source:UniProtKB1 Publication
Biological Process regulation of keratinocyte apoptotic process Source:UniProtKB1 Publication
Biological Process regulation of keratinocyte differentiation Source:UniProtKB1 Publication
Biological Process regulation of keratinocyte proliferation Source:UniProtKB1 Publication
Biological Process regulation of mRNA stability Source:UniProtKB4 Publications
Biological Process regulation of tumor necrosis factor production Source:UniProtKB1 Publication
Biological Process response to starvation Source:UniProtKB1 Publication
Biological Process response to wounding Source:UniProtKB1 Publication
Cellular Location
Nucleus
Cytoplasm
Cytoplasmic granule
Cytoplasm, P-body
Shuttles between nucleus and cytoplasm in a CRM1-dependent manner (By similarity).
Localized predominantly in the cytoplasm in a p38 MAPK- and YWHAB-dependent manner (By similarity).
Colocalizes with SH3KBP1 and MAP3K4 in the cytoplasm (PubMed:20221403).
Component of cytoplasmic stress granules (SGs) (By similarity).
Localizes to cytoplasmic stress granules upon energy starvation (PubMed:15014438).
Localizes in processing bodies (PBs) (PubMed:17369404).
Excluded from stress granules in a phosphorylation MAPKAPK2-dependent manner (By similarity).
Shuttles in and out of both cytoplasmic P-body and SGs (By similarity).
Nucleus
Cytoplasm
(Microbial infection) Colocalizes with HTLV-1 TAX in the nucleus and the cytoplasm in a region surrounding the nucleus.
PTM
Phosphorylated. Phosphorylation at serine and/or threonine residues occurs in a p38 MAPK- and MAPKAPK2-dependent manner (PubMed:16702957).
Phosphorylated by MAPKAPK2 at Ser-60 and Ser-186; phosphorylation increases its stability and cytoplasmic localization, promotes binding to 14-3-3 adapter proteins and inhibits the recruitment of cytoplasmic CCR4-NOT and PAN2-PAN3 deadenylase complexes to the mRNA decay machinery, thereby inhibiting ZFP36-induced ARE-containing mRNA deadenylation and decay processes. Phosphorylation by MAPKAPK2 does not impair ARE-containing RNA-binding. Phosphorylated in a MAPKAPK2- and p38 MAPK-dependent manner upon skeletal muscle satellite cell activation; this phosphorylation inhibits ZFP36-mediated mRNA decay activity, and hence stabilizes MYOD1 mRNA (By similarity).
Phosphorylated by MAPK1 upon mitogen stimulation (By similarity).
Phosphorylated at Ser-66 and Ser-93; these phosphorylations increase in a SH3KBP1-dependent manner (PubMed:20221403).
Phosphorylated at serine and threonine residues in a pyruvate kinase PKM- and p38 MAPK-dependent manner (PubMed:26926077).
Phosphorylation at Ser-60 may participate in the PKM-mediated degradation of ZFP36 in a p38 MAPK-dependent manner (PubMed:26926077).
Dephosphorylated by serine/threonine phosphatase 2A at Ser-186 (By similarity).
Ubiquitinated; pyruvate kinase (PKM)-dependent ubiquitination leads to proteasomal degradation through a p38 MAPK signaling pathway (PubMed:26926077).
Ask a question We look forward to hearing from you.
0 reviews or Q&As
Loading...
Have you used Mouse Anti-ZFP36 Recombinant Antibody (CBYJT-5611)?
Submit a review and get a Coupon or an Amazon gift card. 20% off Coupon $30 eGift Card
Submit a review
Loading...
For research use only. Not intended for any clinical use.

Custom Antibody Labeling

We also offer labeled antibodies developed using our catalog antibody products and nonfluorescent conjugates (HRP, AP, Biotin, etc.) or fluorescent conjugates (Alexa Fluor, FITC, TRITC, Rhodamine, Texas Red, R-PE, APC, Qdot Probes, Pacific Dyes, etc.).

Online Inquiry

Contact us

  • Tel: (USA)
  • (UK)
  • Fax:
  • Email:

Submit A Review

online inquiry
Online Inquiry
Happy Holidays
Happy Holidays close ad