Search :
Sign in or Register  
Welcome Sign in or Don't have an account?Register

Recombinant Mouse Anti-Defensin, beta-1 (a.a. 1-36) Antibody (11-14CB-D10) (CBMAB-MD1331-LY)

Online Inquiry

Summary

Host Animal
Mouse
Specificity
Human
Clone
11-14CB-D10
Antibody Isotype
IgG1
Application
ELISA, WB

Basic Information

Immunogen
Synthetic human beta-Defensin 1 (a.a. 1-36) (DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK)
Specificity
Human
Antibody Isotype
IgG1
Application Notes
The COA includes recommended starting dilutions, optimal dilutions should be determined by the end user.

Formulations & Storage [For reference only, actual COA shall prevail!]

Format
Lyophilized
Buffer
Lyophilized from PBS, pH 7.4.
Storage
Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freezethaw cycles.

Target

Full Name
Defensin Beta 1
Entrez Gene ID
UniProt ID
Function
Has bactericidal activity. May act as a ligand for C-C chemokine receptor CCR6. Positively regulates the sperm motility and bactericidal activity in a CCR6-dependent manner. Binds to CCR6 and triggers Ca2+ mobilization in the sperm which is important for its motility (PubMed:25122636).
Biological Process
Antibacterial humoral response Source: UniProtKB
Antimicrobial humoral immune response mediated by antimicrobial peptide Source: UniProtKB
Antimicrobial humoral response Source: Reactome
Calcium-mediated signaling using intracellular calcium source Source: UniProtKB
cAMP-mediated signaling Source: UniProtKB
Chemotaxis Source: ProtInc
Defense response to bacterium Source: MGI
Defense response to Gram-negative bacterium Source: UniProtKB
Defense response to Gram-positive bacterium Source: UniProtKB
G protein-coupled receptor signaling pathway Source: ProtInc
Immune response Source: ProtInc
Innate immune response Source: UniProtKB
Innate immune response in mucosa Source: UniProtKB
Positive regulation of flagellated sperm motility involved in capacitation Source: UniProtKB
Response to bacterium Source: UniProtKB
Cellular Location
Secreted; Membrane. Associates with tumor cell membrane-derived microvesicles (PubMed:23938203).
More Infomation

Li, S., Li, H., Xu, Y., Ning, W., Hu, S., Wei, S., ... & Liu, M. (2022). Implications of Human Antimicrobial Peptide Defensin Beta-1 in Clinical Oral Squamous Cell Carcinoma Patients via an Integrated Bioinformatics Approach. Computational and Mathematical Methods in Medicine, 2022.

Ślebioda, Z., Woźniak, T., Dorocka‐Bobkowska, B., Woźniewicz, M., & Kowalska, A. (2021). Beta‐defensin 1 gene polymorphisms in the pathologies of the oral cavity—Data from meta‐analysis: Association only with rs1047031 not with rs1800972, rs1799946, and rs11362. Journal of Oral Pathology & Medicine, 50(1), 22-31.

Singh, J. K. J., Vaithilingam, R. D., Ng, C. C., Baharuddin, N. A., Safii, S. H., & Rahman, M. T. (2021). Prostaglandin-endoperoxide synthase (PTGS2) and Defensin beta 1 (DEFB1) gene polymorphisms are not associated with periodontitis in Malays. The Malaysian journal of pathology, 43(3), 425-434.

Salem, R. M., Abdelrahman, A. M. N., Abd El‐Kareem, H. M., & Seif, M. (2021). DEFB1 gene polymorphisms modify vitiligo extent and response to NB‐UVB phototherapy. Dermatologic Therapy, 34(3), e14921.

Antunes, L. S., Carvalho, L., Petean, I. B. F., Antunes, L. A., Freitas, J. V., Salles, A. G., ... & Sousa‐Neto, M. D. (2021). Association between genetic polymorphisms in the promoter region of the defensin beta 1 gene and persistent apical periodontitis. International Endodontic Journal, 54(1), 38-45.

Hatipoğlu, Ö., & Saydam, F. (2020). Association between rs11362 polymorphism in the beta-defensin 1 (DEFB1) gene and dental caries: A meta-analysis. Journal of Oral Biosciences, 62(3), 272-279.

Subbiah, H. V., Babu, P. R., & Subbiah, U. (2020). In silico analysis of non-synonymous single nucleotide polymorphisms of human DEFB1 gene. Egyptian Journal of Medical Human Genetics, 21(1), 1-9.

Kallel, A., Salem, T. B., Hammami, M. B., Said, F., Jemaa, R., Houman, M. H., & Feki, M. (2019). Association of systemic beta-defensin-1 and-20G/A DEFB1 gene polymorphism with Behcet's disease. European journal of internal medicine, 65, 58-62.

Liu, D., Ray, B., Neavin, D. R., Zhang, J., Athreya, A. P., Biernacka, J. M., ... & Weinshilboum, R. M. (2018). Beta-defensin 1, aryl hydrocarbon receptor and plasma kynurenine in major depressive disorder: metabolomics-informed genomics. Translational psychiatry, 8(1), 1-13.

Lips, A., Antunes, L. S., Antunes, L. A., de Abreu, J. G. B., Barreiros, D., de Oliveira, D. S. B., ... & Küchler, E. C. (2017). Genetic polymorphisms in DEFB1 and miRNA202 are involved in salivary human β-defensin 1 levels and caries experience in children. Caries Research, 51(3), 209-215.

Ask a question We look forward to hearing from you.
0 reviews or Q&As
Loading...
Have you used Recombinant Mouse Anti-Defensin, beta-1 (a.a. 1-36) Antibody (11-14CB-D10)?
Submit a review and get a Coupon or an Amazon gift card. 20% off Coupon $30 eGift Card
Submit a review
Loading...
For research use only. Not intended for any clinical use.

Custom Antibody Labeling

We also offer labeled antibodies developed using our catalog antibody products and nonfluorescent conjugates (HRP, AP, Biotin, etc.) or fluorescent conjugates (Alexa Fluor, FITC, TRITC, Rhodamine, Texas Red, R-PE, APC, Qdot Probes, Pacific Dyes, etc.).

Learn more

Documents

Contact us

  • Tel: (USA)
  • (UK)
  • Fax:
  • Email:

Submit A Review

Online Inquiry