Search :
Sign in or Register  
Welcome Sign in or Don't have an account?Register

Mouse Anti-INHBB Recombinant Antibody (10B48) (CBMAB-A4494-YC)

Online Inquiry

Summary

Host Animal
Mouse
Specificity
Human, Rat
Clone
10B48
Antibody Isotype
IgG1
Application
ELISA, IHC, WB

Basic Information

Immunogen
Synthetic peptide, VPTARRPLSLLYYDRDSNIVKTDIPDMVVEAC, corresponding to aa82-113 of mature human activin BetaC-subunit
Specificity
Human, Rat
Antibody Isotype
IgG1
Clonality
Monoclonal
Application Notes
The COA includes recommended starting dilutions, optimal dilutions should be determined by the end user.

Formulations & Storage [For reference only, actual COA shall prevail!]

Format
Liquid in PBS, 0.09% sodium azide
Storage
Store at 4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze/thaw cycles.

Target

Introduction
INHBB is a member of the TGF-beta (transforming growth factor-beta) superfamily of proteins. The encoded preproprotein is proteolytically processed to generate a subunit of the dimeric activin and inhibin protein complexes. These complexes activate and in
Entrez Gene ID
Human3625
Rat25196
UniProt ID
HumanP09529
RatP17491
Alternative Names
Inhibin Beta B Subunit
Function
Inhibins and activins inhibit and activate, respectively, the secretion of follitropin by the pituitary gland. Inhibins/activins are involved in regulating a number of diverse functions such as hypothalamic and pituitary hormone secretion, gonadal hormone secretion, germ cell development and maturation, erythroid differentiation, insulin secretion, nerve cell survival, embryonic axial development or bone growth, depending on their subunit composition. Inhibins appear to oppose the functions of activins.
Biological Process
Activin receptor signaling pathwayManual Assertion Based On ExperimentIDA:UniProtKB
Cell differentiation1 PublicationNAS:UniProtKB
Cellular response to calcium ionIEA:Ensembl
Cellular response to cAMPIEA:Ensembl
Cellular response to cholesterolIEA:Ensembl
Cellular response to insulin stimulusISS:UniProtKB
Cellular response to interleukin-1IEA:Ensembl
Cellular response to leptin stimulusIEA:Ensembl
Cellular response to starvationISS:UniProtKB
Cellular response to Thyroglobulin triiodothyronineIEA:Ensembl
Cellular response to thyroid hormone stimulusIEA:Ensembl
Defense responseManual Assertion Based On ExperimentTAS:UniProtKB
Fat cell differentiationISS:UniProtKB
Negative regulation of follicle-stimulating hormone secretionManual Assertion Based On ExperimentIPI:UniProtKB
Negative regulation of hepatocyte growth factor productionManual Assertion Based On ExperimentIDA:UniProtKB
Negative regulation of insulin secretionISS:UniProtKB
Oocyte developmentIEA:Ensembl
Ovarian follicle development1 PublicationNAS:UniProtKB
Pituitary gland developmentIEA:Ensembl
Positive regulation of apoptotic signaling pathwayIEA:Ensembl
Positive regulation of follicle-stimulating hormone secretionManual Assertion Based On ExperimentIPI:UniProtKB
Positive regulation of ovulationISS:UniProtKB
Positive regulation of pathway-restricted SMAD protein phosphorylationManual Assertion Based On ExperimentIBA:GO_Central
Reproductive senescenceIEA:Ensembl
Response to gonadotropinIEA:Ensembl
Response to insecticideIEA:Ensembl
Response to woundingManual Assertion Based On ExperimentIEP:UniProtKB
Seminiferous tubule developmentIEA:Ensembl
SMAD protein signal transductionManual Assertion Based On ExperimentIBA:GO_Central
SpermatogenesisIEA:Ensembl
Cellular Location
Secreted
More Infomation

Zhang, H., Wang, Z., Zhou, Q., Cao, Z., Jiang, Y., Xu, M., ... & Sun, H. (2023). Downregulated INHBB in endometrial tissue of recurrent implantation failure patients impeded decidualization through the ADCY1/cAMP signalling pathway. Journal of Assisted Reproduction and Genetics, 1-12.

Yang, X., Jia, Q., Zou, Z., Liu, X., Li, X., Chen, H., ... & Chen, L. (2023). INHBB promotes tumor aggressiveness and stemness of glioblastoma via activating EGFR signaling. Pathology-Research and Practice, 245, 154460.

Zhang, H., Zhang, X., & Wang, Z. (2023). P-517 Downregulated INHBB in endometrial tissue of recurrent implantation failure patients impeded decidualization through the ADCY1/cAMP signalling pathway. Human Reproduction, 38(Supplement_1), dead093-860.

Sun, Y., Cai, H., Ge, J., Shao, F., Huang, Z., Ding, Z., ... & Zang, Y. (2022). Tubule‐derived INHBB promotes interstitial fibroblast activation and renal fibrosis. The Journal of pathology, 256(1), 25-37.

Houston, B. J., O’Connor, A. E., Wang, D., Goodchild, G., Merriner, D. J., Luan, H., ... & Walton, K. (2022). Human INHBB gene variant (c. 1079T> C: p. Met360Thr) alters testis germ cell content, but does not impact fertility in mice. Endocrinology, 163(3), bqab269.

Yu, W., He, G., Zhang, W., Ye, Z., Zhong, Z., & Huang, S. (2022). INHBB is a novel prognostic biomarker and correlated with immune infiltrates in gastric cancer. Frontiers in Genetics, 13, 933862.

Chen, Y., Qian, B., Sun, X., Kang, Z., Huang, Z., Ding, Z., ... & Zang, Y. (2021). Sox9/INHBB axis-mediated crosstalk between the hepatoma and hepatic stellate cells promotes the metastasis of hepatocellular carcinoma. Cancer letters, 499, 243-254.

Damavandi, M., Farrokh, P., & Zavareh, S. (2021). Effect of mouse ovarian vitrification on promoter methylation of inhba and inhbb in granulosa cells of follicles. Cryoletters, 42(2), 67-72.

Yuan, J., Xie, A., Cao, Q., Li, X., & Chen, J. (2020). INHBB is a novel prognostic biomarker associated with cancer-promoting pathways in colorectal cancer. BioMed research international, 2020.

Zheng, L., Lu, H., Li, H., Xu, X., & Wang, D. (2020). KLF10 is upregulated in osteoarthritis and inhibits chondrocyte proliferation and migration by upregulating Acvr1 and suppressing inhbb expression. Acta histochemica, 122(3), 151528.

Ask a question We look forward to hearing from you.
0 reviews or Q&As
Loading...
Have you used Mouse Anti-INHBB Recombinant Antibody (10B48)?
Submit a review and get a Coupon or an Amazon gift card. 20% off Coupon $30 eGift Card
Submit a review
Loading...
For research use only. Not intended for any clinical use.

Custom Antibody Labeling

We also offer labeled antibodies developed using our catalog antibody products and nonfluorescent conjugates (HRP, AP, Biotin, etc.) or fluorescent conjugates (Alexa Fluor, FITC, TRITC, Rhodamine, Texas Red, R-PE, APC, Qdot Probes, Pacific Dyes, etc.).

Learn more

Documents

Contact us

  • Tel: (USA)
  • (UK)
  • Fax:
  • Email:

Submit A Review

Online Inquiry