Mouse Anti-LAMB3 Recombinant Antibody (CBYJL-1123) (CBMAB-L0594-YJ)

Go to compare Compare Online Inquiry
Request for COA
Datasheet Target References Q & As Review & reward Protocols Associated Products

Basic Information

Host Animal
Mouse
Clone
CBYJL-1123
Application
WB, IHC-P
Immunogen
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence KLVTSMTKQLGDFWTRMEELRHQARQQGAEAVQAQQLAEGASEQALSAQEGFERIKQKYAELKDRLGQSS mlGEQGARIQSVKTEAEELFGETMEMMDRMKDMELELLRGSQAI mlRSADLTGLEKRVEQ.
Specificity
Human, Rat
Antibody Isotype
IgG1
Clonality
Monoclonal
Application Notes
The COA includes recommended starting dilutions, optimal dilutions should be determined by the end user.

Formulations & Storage [For reference only, actual COA shall prevail!]

Buffer
PBS, pH 7.4
Storage
Store at 4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze/thaw cycles.
More Infomation

Target

Full Name
laminin, beta 3
Introduction
LAMB3 is a laminin that belongs to a family of basement membrane proteins. LAMB3 is a beta subunit laminin, which together with an alpha and a gamma subunit, forms laminin-5. Mutations in this gene cause epidermolysis bullosa junctional Herlitz type, and generalized atrophic benign epidermolysis bullosa, diseases that are characterized by blistering of the skin. Multiple alternatively spliced transcript variants that encode the same protein have been described for this gene. Among its related pathways are ERK Signaling and Focal Adhesion.
Entrez Gene ID
Human3914
Rat305078
UniProt ID
HumanQ13751
RatF1LPI5
Alternative Names
AI1A; BM600-125KDA; LAM5; LAMNB1
Function
Binding to cells via a high affinity receptor, laminin is thought to mediate the attachment, migration and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components.
Biological Process
Animal organ morphogenesisManual Assertion Based On ExperimentIBA:GO_Central
Basement membrane assemblyManual Assertion Based On ExperimentIBA:GO_Central
Brown fat cell differentiationIEA:Ensembl
Cell migrationManual Assertion Based On ExperimentIBA:GO_Central
Endodermal cell differentiationManual Assertion Based On ExperimentIEP:UniProtKB
Epidermis developmentManual Assertion Based On ExperimentTAS:ProtInc
Substrate adhesion-dependent cell spreadingManual Assertion Based On ExperimentIBA:GO_Central
Tissue developmentManual Assertion Based On ExperimentIBA:GO_Central
Cellular Location
Secreted, extracellular space, extracellular matrix, basement membrane
Involvement in disease
Epidermolysis bullosa, junctional, Herlitz type (H-JEB):
An infantile and lethal form of junctional epidermolysis bullosa, a group of blistering skin diseases characterized by tissue separation which occurs within the dermo-epidermal basement In the Herlitz type, death occurs usually within the first six months of life. Occasionally, children survive to teens. It is marked by bullous lesions at birth and extensive denudation of skin and mucous membranes that may be hemorrhagic.
Generalized atrophic benign epidermolysis bullosa (GABEB):
A non-lethal, adult form of junctional epidermolysis bullosa characterized by life-long blistering of the skin, associated with hair and tooth abnormalities.
Amelogenesis imperfecta 1A (AI1A):
A form of amelogenesis imperfecta, a disorder characterized by defective enamel formation. The enamel may be hypoplastic, hypomineralized or both, and affected teeth may be discoloured, sensitive or prone to disintegration.

Zhuang, Q., Liu, G., Huang, W., & He, Z. (2023). Knockdown of LAMB3 suppressed radioresistance in nasopharyngeal carcinoma via deactivating NRF2 signaling pathway. Journal of Radiation Research, 64(3), 509-519.

Zhang, D., Huang, H., Zheng, T., Zhang, L., Cui, B., Liu, Y., ... & Zhao, Y. (2022). Polymeric immunoglobulin receptor suppresses colorectal cancer through the AKT-FOXO3/4 axis by downregulating LAMB3 expression. Frontiers in oncology, 12, 924988.

Islam, S., Kitagawa, T., Baron, B., Abiko, Y., Chiba, I., & Kuramitsu, Y. (2021). ITGA2, LAMB3, and LAMC2 may be the potential therapeutic targets in pancreatic ductal adenocarcinoma: an integrated bioinformatics analysis. Scientific reports, 11(1), 10563.

Zhu, Z., Song, J., Guo, Y., Huang, Z., Chen, X., Dang, X., ... & Cui, L. (2020). LAMB3 promotes tumour progression through the AKT–FOXO3/4 axis and is transcriptionally regulated by the BRD2/acetylated ELK4 complex in colorectal cancer. Oncogene, 39(24), 4666-4680.

Huang, W., Gu, J., Tao, T., Zhang, J., Wang, H., & Fan, Y. (2020). MiR-24-3p inhibits the progression of pancreatic ductal adenocarcinoma through LAMB3 downregulation. Frontiers in oncology, 9, 1499.

Zhang, H., Pan, Y. Z., Cheung, M., Cao, M., Yu, C., Chen, L., ... & Sun, C. Y. (2019). LAMB3 mediates apoptotic, proliferative, invasive, and metastatic behaviors in pancreatic cancer by regulating the PI3K/Akt signaling pathway. Cell Death & Disease, 10(3), 230.

Liu, L., Jung, S. N., Oh, C., Lee, K., Won, H. R., Chang, J. W., ... & Koo, B. S. (2019). LAMB3 is associated with disease progression and cisplatin cytotoxic sensitivity in head and neck squamous cell carcinoma. European Journal of Surgical Oncology, 45(3), 359-365.

Smith, C. E. L., Poulter, J. A., Brookes, S. J., Murillo, G., Silva, S., Brown, C. J., ... & Mighell, A. J. (2019). Phenotype and variant spectrum in the LAMB3 form of amelogenesis imperfecta. Journal of Dental Research, 98(6), 698-704.

Jung, S. N., Lim, H. S., Liu, L., Chang, J. W., Lim, Y. C., Rha, K. S., & Koo, B. S. (2018). LAMB3 mediates metastatic tumor behavior in papillary thyroid cancer by regulating c-MET/Akt signals. Scientific reports, 8(1), 2718.

Benati, D., Miselli, F., Cocchiarella, F., Patrizi, C., Carretero, M., Baldassarri, S., ... & Recchia, A. (2018). CRISPR/Cas9-mediated in situ correction of LAMB3 gene in keratinocytes derived from a junctional epidermolysis bullosa patient. Molecular Therapy, 26(11), 2592-2603.

Ask a question We look forward to hearing from you.
0 reviews or Q&As
Loading...
Have you used Mouse Anti-LAMB3 Recombinant Antibody (CBYJL-1123)?
Submit a review and get a Coupon or an Amazon gift card. 20% off Coupon $30 eGift Card
Submit a review
Loading...
For research use only. Not intended for any clinical use.

Custom Antibody Labeling

We also offer labeled antibodies developed using our catalog antibody products and nonfluorescent conjugates (HRP, AP, Biotin, etc.) or fluorescent conjugates (Alexa Fluor, FITC, TRITC, Rhodamine, Texas Red, R-PE, APC, Qdot Probes, Pacific Dyes, etc.).

Online Inquiry

Contact us

  • Tel: (USA)
  • (UK)
  • Fax:
  • Email:

Submit A Review

online inquiry
Online Inquiry