Mouse Anti-MTDH Recombinant Antibody (CBYJL-252) (CBMAB-L0355-YJ)

Go to compare Compare Online Inquiry
Request for COA
Datasheet Target References Q & As Review & reward Protocols Associated Products

Basic Information

Host Animal
Mouse
Clone
CBYJL-252
Application
WB, IHC, IHC-P
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: RKTEPSAWSQDTGDANTNGKDWGRSWSDRSIFSGIGSTAEPVSQSTTSDYQWDVSRNQPYIDDEWSGLNGLSSADPNSDWNAPAEEWGNWVDEERASLLKSQEPIPDDQKVSDDDKEKGEGALPTGKSKKKKKKKKKQGEDNSTAQD.
Specificity
Human
Antibody Isotype
IgG2a
Clonality
Monoclonal
Application Notes
The COA includes recommended starting dilutions, optimal dilutions should be determined by the end user.

Formulations & Storage [For reference only, actual COA shall prevail!]

Buffer
PBS, pH 7.4
Storage
Store at 4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze/thaw cycles.
More Infomation

Target

Full Name
Metadherin
Introduction
Diseases associated with MTDH include Nervous System Disease and Gallbladder Adenocarcinoma. Among its related pathways are Gastric Cancer Network 2 and Validated targets of C-MYC transcriptional activation. Gene Ontology (GO) annotations related to this gene include double-stranded RNA binding.
Entrez Gene ID
UniProt ID
Alternative Names
Metadherin; Lysine-Rich CEACAM1 Co-Isolated Protein; Astrocyte Elevated Gene-1 Protein; Metastasis Adhesion Protein; Astrocyte Elevated Gene 1; 3D3/LYRIC; AEG-1
Function
Down-regulates SLC1A2/EAAT2 promoter activity when expressed ectopically. Activates the nuclear factor kappa-B (NF-kappa-B) transcription factor. Promotes anchorage-independent growth of immortalized melanocytes and astrocytes which is a key component in tumor cell expansion. Promotes lung metastasis and also has an effect on bone and brain metastasis, possibly by enhancing the seeding of tumor cells to the target organ endothelium. Induces chemoresistance.
Biological Process
Lipopolysaccharide-mediated signaling pathway Source: UniProtKB
Negative regulation of apoptotic process Source: UniProtKB
Negative regulation of transcription by RNA polymerase II Source: UniProtKB
Positive regulation of angiogenesis Source: UniProtKB
Positive regulation of autophagy Source: UniProtKB
Positive regulation of I-kappaB kinase/NF-kappaB signaling Source: UniProtKB
Positive regulation of NF-kappaB transcription factor activity Source: UniProtKB
Positive regulation of protein kinase B signaling Source: UniProtKB
Regulation of transcription by RNA polymerase II Source: GO_Central
Cellular Location
Nucleus
Nucleus membrane
nucleolus
Endoplasmic reticulum
Endoplasmic reticulum membrane
Other locations
tight junction
perinuclear region
Note: In epithelial cells, recruited to tight junctions (TJ) during the maturation of the TJ complexes. A nucleolar staining may be due to nuclear targeting of an isoform lacking the transmembrane domain (By similarity). TNF-alpha causes translocation from the cytoplasm to the nucleus.
Topology
Lumenal: 1-48
Helical: 49-69
Cytoplasmic: 70-582

Ortiz-Soto, G., Babilonia-Díaz, N. S., Lacourt-Ventura, M. Y., Rivera-Rodríguez, D. M., Quiñones-Rodríguez, J. I., Colón-Vargas, M., ... & Martínez-Montemayor, M. M. (2023). Metadherin Regulates Inflammatory Breast Cancer Invasion and Metastasis. International Journal of Molecular Sciences, 24(5), 4694.

Wang, S. S., Zhai, G. Q., Chen, G., Huang, Z. G., Zhang, Y., Zhang, L. J., ... & Yan, H. B. (2023). Metadherin promotes the development of bladder cancer by enhancing cell division. Cancer Biotherapy & Radiopharmaceuticals, 38(9), 650-662.

Ghafar, M. T. A., & Soliman, N. A. (2022). Metadherin (AEG-1/MTDH/LYRIC) expression: significance in malignancy and crucial role in colorectal cancer. Advances in clinical chemistry, 106, 235-280.

Chen, Y., Huang, S., Guo, R., & Chen, D. (2021). Metadherin-mediated mechanisms in human malignancies. Biomarkers in Medicine, 15(18), 1769-1783.

Sultan, A., Sahar, N. E., Riaz, S. K., Qadir, J., Waqar, S. H., Haq, F., ... & Malik, M. F. A. (2021). Metadherin (MTDH) overexpression significantly correlates with advanced tumor grade and stages among colorectal cancer patients. Molecular Biology Reports, 48(12), 7999-8007.

Shen, M., Xie, S., Rowicki, M., Michel, S., Wei, Y., Hang, X., ... & Kang, Y. (2021). Therapeutic targeting of metadherin suppresses colorectal and lung cancer progression and metastasis. Cancer research, 81(4), 1014-1025.

Rong, C., Shi, Y., Huang, J., Wang, X., Shimizu, R., Mori, Y., ... & Liang, J. (2020). The effect of metadherin on NF-κB activation and downstream genes in ovarian cancer. Cell transplantation, 29, 0963689720905506.

Bi, J., Yang, S., Li, L., Dai, Q., Borcherding, N., Wagner, B. A., ... & Meng, X. (2019). Metadherin enhances vulnerability of cancer cells to ferroptosis. Cell death & disease, 10(10), 682.

Dhiman, G., Srivastava, N., Goyal, M., Rakha, E., Lothion-Roy, J., Mongan, N. P., ... & Baranwal, M. (2019). Metadherin: a therapeutic target in multiple cancers. Frontiers in oncology, 9, 349.

Zhang, Z., Qin, H., Jiang, B., Chen, W., Cao, W., Zhao, X., ... & Guo, H. (2019). miR‐30e‐5p suppresses cell proliferation and migration in bladder cancer through regulating metadherin. Journal of Cellular Biochemistry, 120(9), 15924-15932.

Ask a question We look forward to hearing from you.
0 reviews or Q&As
Loading...
Have you used Mouse Anti-MTDH Recombinant Antibody (CBYJL-252)?
Submit a review and get a Coupon or an Amazon gift card. 20% off Coupon $30 eGift Card
Submit a review
Loading...
For research use only. Not intended for any clinical use.

Custom Antibody Labeling

We also offer labeled antibodies developed using our catalog antibody products and nonfluorescent conjugates (HRP, AP, Biotin, etc.) or fluorescent conjugates (Alexa Fluor, FITC, TRITC, Rhodamine, Texas Red, R-PE, APC, Qdot Probes, Pacific Dyes, etc.).

Online Inquiry

Contact us

  • Tel: (USA)
  • (UK)
  • Fax:
  • Email:

Submit A Review

online inquiry
Online Inquiry
Happy Holidays
Happy Holidays close ad